| Clone Name | rbart27c04 |
|---|---|
| Clone Library Name | barley_pub |
>SCX3_MESTA (P83400) Neurotoxin BtITx3 precursor (Neurotoxin BTChl1)| Length = 60 Score = 30.4 bits (67), Expect = 3.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -3 Query: 299 SLLPCLFWRLFVPTNSSACCPVCFGTRPSVE 207 ++L F + + T+S A CP CF T P++E Sbjct: 7 TILIAFFLTVMIATHSEARCPPCFTTNPNME 37
>NOX3_HUMAN (Q9HBY0) NADPH oxidase 3 (EC 1.6.3.-) (gp91phox homolog 3) (GP91-3)| (Mitogenic oxidase 2) Length = 568 Score = 30.0 bits (66), Expect = 4.4 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 2 YNLHLYHEKESQ*GTCLLFLLKKIGNNSQESY 97 +NL YH +S+ LL L K+GN ESY Sbjct: 122 FNLERYHWSQSEEAQGLLAALSKLGNTPNESY 153
>SRY_ELADA (Q863B7) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 29.6 bits (65), Expect = 5.7 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 194 TWAPFQLKDGCQNKQGSRLMS--*LAQTVSRTN 286 T PF +DGC N GSR+ S L+Q+V+ TN Sbjct: 151 TLQPFTYRDGCANTTGSRMESQLSLSQSVTITN 183
>SRY_CERAL (Q863C0) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 29.6 bits (65), Expect = 5.7 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 194 TWAPFQLKDGCQNKQGSRLMS--*LAQTVSRTN 286 T PF +DGC N GSR+ S L+Q+V+ TN Sbjct: 151 TLQPFTYRDGCANTTGSRMESQLSLSQSVTITN 183
>SRY_AXIPR (Q863C2) Sex-determining region Y protein (Testis-determining| factor) Length = 229 Score = 28.9 bits (63), Expect = 9.7 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +2 Query: 194 TWAPFQLKDGCQNKQGSRLMS--*LAQTVSRTN 286 T PF +DGC N GSR+ S L+Q+V+ TN Sbjct: 151 TLQPFIYRDGCANTTGSRMESQLSLSQSVTITN 183 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,855,557 Number of Sequences: 219361 Number of extensions: 1545570 Number of successful extensions: 3382 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3382 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4315578075 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)