| Clone Name | rbart26f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZFYV9_HUMAN (O95405) Zinc finger FYVE domain-containing protein ... | 32 | 0.93 | 2 | SPS_SOLTU (Q43845) Sucrose-phosphate synthase (EC 2.4.1.14) (UDP... | 30 | 4.6 | 3 | FRI4_SOYBN (Q948P5) Ferritin-4, chloroplast precursor (EC 1.16.3... | 30 | 6.0 | 4 | CENPC_HUMAN (Q03188) Centromere protein C 1 (CENP-C) (Centromere... | 29 | 7.9 |
|---|
>ZFYV9_HUMAN (O95405) Zinc finger FYVE domain-containing protein 9 (Mothers| against decapentaplegic homolog-interacting protein) (Madh-interacting protein) (Smad anchor for receptor activation) (Receptor activation anchor) (hSARA) (Novel serine protease) Length = 1425 Score = 32.3 bits (72), Expect = 0.93 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +2 Query: 92 TNERLLSTHHVATSSGMT-----ALRKTNETQVN*EYKNWPLISQPKATQGEQRKWLSSC 256 T E L T H + S MT L + N++QVN E + + ISQP+ T G+ Sbjct: 383 TTEFLNMTEHFSESQDMTNWKLTKLNEMNDSQVNEEKEKFLQISQPEDTNGDSGGQCVGL 442 Query: 257 LQMKHREKSSCIAXS 301 K +CI+ S Sbjct: 443 ADAGLDLKGTCISES 457
>SPS_SOLTU (Q43845) Sucrose-phosphate synthase (EC 2.4.1.14)| (UDP-glucose-fructose-phosphate glucosyltransferase) Length = 1053 Score = 30.0 bits (66), Expect = 4.6 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 185 YKNWPLISQPKATQGEQRKWLSSCLQMKHREKSSCIAXS*QNRSE 319 ++ W L Q K +GEQ +W++ Q + R + +A ++ SE Sbjct: 80 WRIWNLARQKKQLEGEQAQWMAKRRQERERGRREAVADMSEDLSE 124
>FRI4_SOYBN (Q948P5) Ferritin-4, chloroplast precursor (EC 1.16.3.1) (SFerH-4)| Length = 247 Score = 29.6 bits (65), Expect = 6.0 Identities = 17/36 (47%), Positives = 22/36 (61%) Frame = +2 Query: 65 EV*LSLLITTNERLLSTHHVATSSGMTALRKTNETQ 172 E+ LSL TNE+LL+ H VAT +G L ET+ Sbjct: 169 ELALSLEKLTNEKLLNLHSVATKNGDVQLADFVETE 204
>CENPC_HUMAN (Q03188) Centromere protein C 1 (CENP-C) (Centromere autoantigen C)| Length = 943 Score = 29.3 bits (64), Expect = 7.9 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = +2 Query: 107 LSTHHVATSSGMTALRKTNETQVN*EYKNWPLISQPKATQGEQR 238 L HH +S + +KTN++ N K PL Q AT+G QR Sbjct: 550 LPMHH---NSSRKSTKKTNQSSKNIRKKTIPLKRQKTATKGNQR 590 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,774,172 Number of Sequences: 219361 Number of extensions: 1128855 Number of successful extensions: 2210 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2210 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4545742239 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)