| Clone Name | rbart26d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DFG16_YEAST (Q99234) Protein DFG16 (Extracellular matrix protein... | 29 | 4.0 | 2 | LACY_KLEPN (P59832) Lactose permease (Lactose-proton symport) (F... | 28 | 8.8 |
|---|
>DFG16_YEAST (Q99234) Protein DFG16 (Extracellular matrix protein 41)| (Zinc-regulated gene 11 protein) Length = 619 Score = 28.9 bits (63), Expect = 4.0 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +1 Query: 13 KNLLIMSIYMPYFAL*IYTINSTLKLPSPHIFFSSSNFAHVLLP 144 KNL+++ ++ L IYTI S +F+ NFA++LLP Sbjct: 315 KNLVVLKVFYKLIELLIYTI-----FISIICYFTWHNFAYILLP 353
>LACY_KLEPN (P59832) Lactose permease (Lactose-proton symport) (Fragment)| Length = 131 Score = 27.7 bits (60), Expect = 8.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +1 Query: 25 IMSIYMPYFAL*IYTINSTLKLPSPHIFFSSSNFAHVLLP 144 IMS Y P+F + + +N K + +F S S FA + P Sbjct: 27 IMSAYFPFFPVWLADVNHLTKTETGIVFSSISLFAIIFQP 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,825,483 Number of Sequences: 219361 Number of extensions: 400283 Number of successful extensions: 905 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 904 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)