| Clone Name | rbart25g12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NSD1_MOUSE (O88491) Histone-lysine N-methyltransferase, H3 lysin... | 30 | 2.2 | 2 | MTH2_DROME (Q9VRN2) Probable G-protein coupled receptor Mth-like... | 29 | 3.7 | 3 | NSD1_HUMAN (Q96L73) Histone-lysine N-methyltransferase, H3 lysin... | 29 | 3.7 | 4 | GP151_RAT (Q7TSN5) Probable G-protein coupled receptor 151 (GPCR... | 28 | 4.8 |
|---|
>NSD1_MOUSE (O88491) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) Length = 2588 Score = 29.6 bits (65), Expect = 2.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 151 CYPVMCPSGFICLNVCFA 98 C+P +CP+G C N CF+ Sbjct: 1818 CHPTVCPAGVRCQNQCFS 1835
>MTH2_DROME (Q9VRN2) Probable G-protein coupled receptor Mth-like 2 precursor| (Protein methuselah-like 2) Length = 518 Score = 28.9 bits (63), Expect = 3.7 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 2/57 (3%) Frame = -3 Query: 170 LPPGVLLLPCDVPEWVYLFECLLCFVV-VGLHPCCKTLWYV-*PCFAPWLICMLSGF 6 +P L+LP + V + L+C V+ + ++ C K L + CF +++C+ G+ Sbjct: 207 IPHNCLILPSRTGQTVVMITSLICLVLTIAVYLCVKKLMNLEGKCFICYMMCLFFGY 263
>NSD1_HUMAN (Q96L73) Histone-lysine N-methyltransferase, H3 lysine-36 and H4| lysine-20 specific (EC 2.1.1.43) (H3-K36-HMTase) (H4-K20-HMTase) (Nuclear receptor binding SET domain containing protein 1) (NR-binding SET domain containing protein) (Androgen r Length = 2696 Score = 28.9 bits (63), Expect = 3.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 151 CYPVMCPSGFICLNVCFA 98 C+P +CP+G C N CF+ Sbjct: 1920 CHPTVCPAGGRCQNQCFS 1937
>GP151_RAT (Q7TSN5) Probable G-protein coupled receptor 151 (GPCR-2037)| Length = 421 Score = 28.5 bits (62), Expect = 4.8 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -1 Query: 139 MCPSGFICLNVCFALWWLVYTRVVRPCGMF--DPASPLG*YACYLVSL 2 +C S ++C A L + V + C M+ DPA P+G + C + SL Sbjct: 113 VCKSSDWFTHMCMAAKSLTFVVVAKVCFMYASDPAKPVGTHNCTIWSL 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.131 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,895,838 Number of Sequences: 219361 Number of extensions: 601269 Number of successful extensions: 1745 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1745 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits)