| Clone Name | rbart25f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLP_YEAST (P03870) Recombinase Flp protein (Protein Able) | 31 | 2.3 | 2 | CARB_XANCP (P58943) Carbamoyl-phosphate synthase large chain (EC... | 29 | 6.6 | 3 | PMPB_CHLTR (O84418) Probable outer membrane protein pmpB precurs... | 29 | 6.6 | 4 | LGR5_HUMAN (O75473) Leucine-rich repeat-containing G-protein cou... | 29 | 6.6 |
|---|
>FLP_YEAST (P03870) Recombinase Flp protein (Protein Able)| Length = 423 Score = 30.8 bits (68), Expect = 2.3 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = -2 Query: 346 QQHHQCFTQCRLARGGQQPESADQQRGRAHSQPQGRLLLRAGDMGWRVADALLGLTE-TA 170 Q+H T + Q S + +G +HS+ + LL G+ W + + +L E T+ Sbjct: 110 QKHQSDITDIVSSLQLQFESSEEADKGNSHSKKMLKALLSEGESIWEITEKILNSFEYTS 169 Query: 169 TSTLRRAVIWFLFRMT 122 T + + FLF T Sbjct: 170 RFTKTKTLYQFLFLAT 185
>CARB_XANCP (P58943) Carbamoyl-phosphate synthase large chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase ammonia chain) Length = 1080 Score = 29.3 bits (64), Expect = 6.6 Identities = 18/35 (51%), Positives = 23/35 (65%) Frame = -2 Query: 250 PQGRLLLRAGDMGWRVADALLGLTETATSTLRRAV 146 P+ RLL RAG R+A+ L+G E A TLRRA+ Sbjct: 488 PRLRLLKRAGFSDARLAE-LIGTNEEAVRTLRRAL 521
>PMPB_CHLTR (O84418) Probable outer membrane protein pmpB precursor| (Polymorphic membrane protein B) Length = 1754 Score = 29.3 bits (64), Expect = 6.6 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 13/62 (20%) Frame = +1 Query: 109 NASSMSSGKETILQPAATCSSPFPSNLEEH-------------QRRASPYHQRGGAGGLE 249 + SS SSG +++ P+++ + P +NL+ H ++P H+ G G + Sbjct: 215 SGSSSSSGNDSVSSPSSSRAEPAAANLQSHFICATATPAAQTDTETSTPSHKPGSGGAIY 274 Query: 250 AE 255 A+ Sbjct: 275 AK 276
>LGR5_HUMAN (O75473) Leucine-rich repeat-containing G-protein coupled receptor| 5 precursor (Orphan G-protein coupled receptor HG38) (G-protein coupled receptor 49) (G-protein coupled receptor 67) Length = 907 Score = 29.3 bits (64), Expect = 6.6 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 5/40 (12%) Frame = -2 Query: 316 RLARGGQQPESADQQRG---RAHSQPQGRLLLR--AGDMG 212 +LA GG P S RG H +P GR+LLR D+G Sbjct: 17 QLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLG 56 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,463,852 Number of Sequences: 219361 Number of extensions: 993725 Number of successful extensions: 3842 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3840 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)