| Clone Name | rbart24b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IF2_BORPA (Q7W9A5) Translation initiation factor IF-2 | 29 | 7.1 | 2 | IF2_BORBR (Q7WHG2) Translation initiation factor IF-2 | 29 | 7.1 | 3 | GCY_ARBPU (P11528) Resact receptor precursor (Guanylate cyclase)... | 28 | 9.2 | 4 | LCF4_YEAST (P47912) Long-chain-fatty-acid--CoA ligase 4 (EC 6.2.... | 28 | 9.2 | 5 | IF2_BORPE (Q7VYR2) Translation initiation factor IF-2 | 28 | 9.2 |
|---|
>IF2_BORPA (Q7W9A5) Translation initiation factor IF-2| Length = 969 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -2 Query: 308 SERAESLELPFQGEGKRRRLLLPREQTLEPQANFGHSKADLSEVALF*GTSWKGKQSCLV 129 S+ ++ E+ +GK R + L R+Q + ++ F + +AL T +G Q LV Sbjct: 726 SDERKAREIALFRQGKFRDVKLARQQAAKLESMFDNLGEGTQTLALIVKTDVQGSQEALV 785 Query: 128 ASL 120 +SL Sbjct: 786 SSL 788
>IF2_BORBR (Q7WHG2) Translation initiation factor IF-2| Length = 997 Score = 28.9 bits (63), Expect = 7.1 Identities = 18/63 (28%), Positives = 32/63 (50%) Frame = -2 Query: 308 SERAESLELPFQGEGKRRRLLLPREQTLEPQANFGHSKADLSEVALF*GTSWKGKQSCLV 129 S+ ++ E+ +GK R + L R+Q + ++ F + +AL T +G Q LV Sbjct: 754 SDERKAREIALFRQGKFRDVKLARQQAAKLESMFDNLGEGTQTLALIVKTDVQGSQEALV 813 Query: 128 ASL 120 +SL Sbjct: 814 SSL 816
>GCY_ARBPU (P11528) Resact receptor precursor (Guanylate cyclase) (EC 4.6.1.2)| Length = 986 Score = 28.5 bits (62), Expect = 9.2 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = +2 Query: 161 FLKTGQLHSSLLYCGQSSLVVLMSAPWVEEVCAVFLHLEM-----EVPNFLPFRWSLLDE 325 FL L S L+C SS V+ + PW+ + + LHL + + +F WS L Sbjct: 920 FLIHFSLSSCRLFC--SSQVLPLLVPWLHSLLTLPLHLPLIWMNPLISSFAQPSWSALHS 977 Query: 326 HS 331 HS Sbjct: 978 HS 979
>LCF4_YEAST (P47912) Long-chain-fatty-acid--CoA ligase 4 (EC 6.2.1.3)| (Long-chain acyl-CoA synthetase 4) (Fatty acid activator 4) Length = 694 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 126 ISLRLFLDSLCCPYFIGKGYALNIVRASLVEPSN 25 I + FL +L CP IG G + A ++EP + Sbjct: 435 IDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEH 468
>IF2_BORPE (Q7VYR2) Translation initiation factor IF-2| Length = 997 Score = 28.5 bits (62), Expect = 9.2 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = -2 Query: 308 SERAESLELPFQGEGKRRRLLLPREQTLEPQANFGHSKADLSEVALF*GTSWKGKQSCLV 129 S+ ++ E+ +GK R + L R+Q ++ F + +AL T +G Q LV Sbjct: 754 SDERKAREIALFRQGKFRDVKLARQQAANLESMFDNLGEGTQTLALIVKTDVQGSQEALV 813 Query: 128 ASL 120 +SL Sbjct: 814 SSL 816 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,609,722 Number of Sequences: 219361 Number of extensions: 1337991 Number of successful extensions: 2951 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2912 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2951 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)