| Clone Name | rbart23d04 |
|---|---|
| Clone Library Name | barley_pub |
>KPRS4_ORYSA (Q6ZFT5) Ribose-phosphate pyrophosphokinase 4 (EC 2.7.6.1)| (Phosphoribosyl pyrophosphate synthetase 4) Length = 325 Score = 107 bits (268), Expect = 1e-23 Identities = 52/62 (83%), Positives = 54/62 (87%) Frame = -1 Query: 491 THAVFPNQSYERFMTANSAEPGDQFAYFWITDSCPQTVKAISQQPPFEVLSLASSIADAL 312 THAVFP QSYERF NSA D+FAYFWITDSCPQTVKAI+QQPPFEVLSLA SIADAL Sbjct: 264 THAVFPKQSYERFTHTNSAGSADKFAYFWITDSCPQTVKAINQQPPFEVLSLAGSIADAL 323 Query: 311 QI 306 QI Sbjct: 324 QI 325
>KPRS4_ARATH (Q680A5) Ribose-phosphate pyrophosphokinase 4 (EC 2.7.6.1)| (Phosphoribosyl pyrophosphate synthetase 4) Length = 337 Score = 83.2 bits (204), Expect = 4e-16 Identities = 44/63 (69%), Positives = 47/63 (74%), Gaps = 1/63 (1%) Frame = -1 Query: 491 THAVFPNQSYERFM-TANSAEPGDQFAYFWITDSCPQTVKAISQQPPFEVLSLASSIADA 315 TH VFP S+ERF N E + FAYFWITDSCPQTVKAI + PFEVLSLA SIADA Sbjct: 277 THGVFPKSSWERFTHKKNGLE--EAFAYFWITDSCPQTVKAIGNKAPFEVLSLAGSIADA 334 Query: 314 LQI 306 LQI Sbjct: 335 LQI 337
>KPRS4_SPIOL (Q9XGA1) Ribose-phosphate pyrophosphokinase 4 (EC 2.7.6.1)| (Phosphoribosyl pyrophosphate synthetase 4) Length = 318 Score = 81.3 bits (199), Expect = 1e-15 Identities = 41/62 (66%), Positives = 46/62 (74%) Frame = -1 Query: 491 THAVFPNQSYERFMTANSAEPGDQFAYFWITDSCPQTVKAISQQPPFEVLSLASSIADAL 312 THAVFP S+ERF T F YFWITDSCP+TVK+I+ + PFEVLSLA SIADAL Sbjct: 258 THAVFPKNSFERF-THKDDGSDKAFTYFWITDSCPRTVKSIANKAPFEVLSLAGSIADAL 316 Query: 311 QI 306 QI Sbjct: 317 QI 318
>KPRS3_SPIOL (Q9XGA0) Ribose-phosphate pyrophosphokinase 3, mitochondrial| precursor (EC 2.7.6.1) (Phosphoribosyl pyrophosphate synthetase 3) Length = 406 Score = 79.7 bits (195), Expect = 4e-15 Identities = 36/62 (58%), Positives = 45/62 (72%) Frame = -1 Query: 491 THAVFPNQSYERFMTANSAEPGDQFAYFWITDSCPQTVKAISQQPPFEVLSLASSIADAL 312 TH +FPN+S+ERF + P + +FWITDSCP TVK + +PPFEV+SLA SIA AL Sbjct: 345 THGIFPNKSWERFKPDTAGCPEEGMTHFWITDSCPLTVKMVKNRPPFEVISLAGSIAAAL 404 Query: 311 QI 306 QI Sbjct: 405 QI 406
>KPRS3_ORYSA (Q8S2E5) Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1)| (Phosphoribosyl pyrophosphate synthetase 3) Length = 409 Score = 79.7 bits (195), Expect = 4e-15 Identities = 35/62 (56%), Positives = 44/62 (70%) Frame = -1 Query: 491 THAVFPNQSYERFMTANSAEPGDQFAYFWITDSCPQTVKAISQQPPFEVLSLASSIADAL 312 TH +FPN+S+E+F N PG ++FWITDSCP TV A+ + PFE+LSLA IA AL Sbjct: 348 THGIFPNKSWEKFQPDNGEGPGHGLSHFWITDSCPLTVNAVKDRQPFEILSLAGPIASAL 407 Query: 311 QI 306 QI Sbjct: 408 QI 409
>KPRS3_ARATH (Q93Z66) Ribose-phosphate pyrophosphokinase 3 (EC 2.7.6.1)| (Phosphoribosyl pyrophosphate synthetase 3) Length = 411 Score = 78.6 bits (192), Expect = 9e-15 Identities = 34/62 (54%), Positives = 43/62 (69%) Frame = -1 Query: 491 THAVFPNQSYERFMTANSAEPGDQFAYFWITDSCPQTVKAISQQPPFEVLSLASSIADAL 312 TH +FP S++RF +P + +YFWITDSC TVK + +PPFEVLSLA SIA AL Sbjct: 350 THGIFPRSSWKRFKLDTKGDPAEGLSYFWITDSCGMTVKEVMNKPPFEVLSLAGSIASAL 409 Query: 311 QI 306 Q+ Sbjct: 410 QV 411
>KPRS_MYCGE (P47304) Ribose-phosphate pyrophosphokinase (EC 2.7.6.1) (RPPK)| (Phosphoribosyl pyrophosphate synthetase) (P-Rib-PP synthetase) (PRPP synthetase) Length = 344 Score = 29.3 bits (64), Expect = 6.0 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%) Frame = -1 Query: 491 THAVFPNQSYERFMTANSAEPGDQFAYFWITDSCPQ-TVKAISQQPPFEVLSLAS 330 TH +F N + ++FM A + D + ++++S PQ KA+ Q FEV+ LAS Sbjct: 266 THGLFNNDAEQKFMEAFDQKLID---FLFVSNSIPQYKFKAVKQ---FEVVDLAS 314
>TM7S4_HUMAN (Q9H295) Transmembrane 7 superfamily member 4 (Dendritic| cell-specific transmembrane protein) (DC-STAMP) (IL-4-induced protein) (FIND) Length = 470 Score = 28.9 bits (63), Expect = 7.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 150 WIFTCTVLCIRF*CSRPGRCFNFLTW 73 WI TC +LC CS+ RCF L + Sbjct: 65 WIITCVLLC----CSKHARCFILLVF 86 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,926,730 Number of Sequences: 219361 Number of extensions: 1273923 Number of successful extensions: 2800 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2750 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2797 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)