| Clone Name | rbart22f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2... | 30 | 2.9 | 2 | AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11 | 29 | 5.0 | 3 | CAC1D_RAT (P27732) Voltage-dependent L-type calcium channel alph... | 28 | 8.6 | 4 | PALI_YARLI (Q7Z8R5) pH-response regulator protein palI/RIM9 | 28 | 8.6 |
|---|
>ZDH20_MOUSE (Q5Y5T1) Probable palmitoyltransferase ZDHHC20 (EC 2.3.1.-) (Zinc| finger DHHC domain-containing protein 20) (DHHC-20) Length = 380 Score = 29.6 bits (65), Expect = 2.9 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 144 CCVRCVTWSALPFPTFIFASYSTLHYHLGLCVSLFVRVG 28 CC R V W + F TF+ +S Y + LCVS R G Sbjct: 9 CCQRVVGWVPVLFITFVVV-WSYYAYVVELCVSTISRTG 46
>AGL11_ARATH (Q38836) Agamous-like MADS-box protein AGL11| Length = 230 Score = 28.9 bits (63), Expect = 5.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 401 TKAKLFRRFHQHHHAHDSENEVDEVEELARK 309 TK R+ QHHH S +E++ +E LA + Sbjct: 169 TKVAEVERYQQHHHQMVSGSEINAIEALASR 199
>CAC1D_RAT (P27732) Voltage-dependent L-type calcium channel alpha-1D subunit| (Voltage-gated calcium channel alpha subunit Cav1.3) (Calcium channel, L type, alpha-1 polypeptide, isoform 2) (RAT brain class D) (RBD) Length = 2203 Score = 28.1 bits (61), Expect = 8.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 364 WCWWKRRNSFAFVPS 408 WCWWKRR + PS Sbjct: 493 WCWWKRRGAAKTGPS 507
>PALI_YARLI (Q7Z8R5) pH-response regulator protein palI/RIM9| Length = 728 Score = 28.1 bits (61), Expect = 8.6 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 13/70 (18%) Frame = -2 Query: 178 PAAG*FTLVINLLCAMRDVERSAIS--YLYFCFVFHITLPLGFMC*FICE---------- 35 P A FTL++ +L + ++ A S YL FC VF + L + F+ + Sbjct: 93 PIATGFTLILTVLAMLAHIQGPASSSRYLLFCLVFSLPTFLLVLLSFLVDILLFVPHLDW 152 Query: 34 -GWEIIRAAV 8 GW ++ A + Sbjct: 153 GGWIVLAATI 162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,154,378 Number of Sequences: 219361 Number of extensions: 786678 Number of successful extensions: 2767 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2700 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)