| Clone Name | rbart20e11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG2_CANAL (Q59X11) Autophagy-related protein 2 | 29 | 6.0 | 2 | VIM1_CARAU (P48671) Vimentin A1 (Fragment) | 29 | 7.8 | 3 | ALS2_PANTR (Q5BIW4) Alsin (Amyotrophic lateral sclerosis protein... | 29 | 7.8 | 4 | ALS2_HUMAN (Q96Q42) Alsin (Amyotrophic lateral sclerosis protein 2) | 29 | 7.8 |
|---|
>ATG2_CANAL (Q59X11) Autophagy-related protein 2| Length = 1856 Score = 29.3 bits (64), Expect = 6.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 274 SISIWNLVCSYVTLVGTREFGTLLYK 197 S S WN SY+ ++G RE GT + K Sbjct: 1377 STSTWNKFLSYMNILGDREIGTSMVK 1402
>VIM1_CARAU (P48671) Vimentin A1 (Fragment)| Length = 170 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +1 Query: 139 RKILHPDHEKTSRPLPSTTIYTARSQTLEYQPTSHSYKLNSICLC---LRGGRILN 297 RK+L + + S PLP+ + + R LE +P S + + R G++LN Sbjct: 105 RKLLEGEESRISTPLPNFSSFNLRETMLELKPNIESTFTKKVLIKTIETRDGQVLN 160
>ALS2_PANTR (Q5BIW4) Alsin (Amyotrophic lateral sclerosis protein 2 homolog)| Length = 1657 Score = 28.9 bits (63), Expect = 7.8 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 7/80 (8%) Frame = +1 Query: 115 TTCCNKKLRKI----LHPDHEKTSRPLPSTTIYTARSQTLEYQPTSHSYKLNSI---CLC 273 T N+ LRK+ + D E +P+PS + L PT+ + LNS+ C Sbjct: 342 TQAVNEYLRKLSDHSVREDSEHGEKPMPSQPLLEEAIPNLHSPPTTSTSALNSLVVSCAS 401 Query: 274 LRGGRILNVDGGATLSLTGV 333 G R+ LSL V Sbjct: 402 AVGVRVAATYEAGALSLKKV 421
>ALS2_HUMAN (Q96Q42) Alsin (Amyotrophic lateral sclerosis protein 2)| Length = 1657 Score = 28.9 bits (63), Expect = 7.8 Identities = 23/80 (28%), Positives = 33/80 (41%), Gaps = 7/80 (8%) Frame = +1 Query: 115 TTCCNKKLRKI----LHPDHEKTSRPLPSTTIYTARSQTLEYQPTSHSYKLNSI---CLC 273 T N+ LRK+ + D E +P+PS + L PT+ + LNS+ C Sbjct: 342 TQAVNEYLRKLSDHSVREDSEHGEKPMPSQPLLEEAIPNLHSPPTTSTSALNSLVVSCAS 401 Query: 274 LRGGRILNVDGGATLSLTGV 333 G R+ LSL V Sbjct: 402 AVGVRVAATYEAGALSLKKV 421 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,891,408 Number of Sequences: 219361 Number of extensions: 1261747 Number of successful extensions: 3069 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2962 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3069 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)