| Clone Name | rbart18g06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PAP2_HUMAN (Q9BXP8) Pappalysin-2 precursor (EC 3.4.24.-) (Pregna... | 29 | 3.2 | 2 | MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methyl... | 28 | 5.4 | 3 | UQCR2_CANGA (Q6FSJ3) Ubiquinol-cytochrome-c reductase complex co... | 27 | 9.2 | 4 | UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (E... | 27 | 9.2 |
|---|
>PAP2_HUMAN (Q9BXP8) Pappalysin-2 precursor (EC 3.4.24.-) (Pregnancy-associated| plasma protein-A2) (PAPP-A2) (Pregnancy-associated plasma protein-E1) (PAPP-E) Length = 1791 Score = 28.9 bits (63), Expect = 3.2 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -1 Query: 347 VQALLRGRRRLTHPSPIILHCVAS 276 VQ+++ RR HP P+++HC+ S Sbjct: 1709 VQSIVCTGRRQWHPDPVLVHCIQS 1732
>MTNN_TREPA (P96122) MTA/SAH nucleosidase (EC 3.2.2.9) (5'-methylthioadenosine| nucleosidase) (S-adenosylhomocysteine nucleosidase) Length = 269 Score = 28.1 bits (61), Expect = 5.4 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 205 TSNARLVIAAPD*FSLCDRRPSWTDATQCRMMGDG 309 T+N L + F LC R P WT+ C + G G Sbjct: 120 TANTALRYLVREAFDLCTRDPEWTEGA-CALSGSG 153
>UQCR2_CANGA (Q6FSJ3) Ubiquinol-cytochrome-c reductase complex core protein 2,| mitochondrial precursor (EC 1.10.2.2) Length = 364 Score = 27.3 bits (59), Expect = 9.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 49 YQCTNMNQSVQLIRLSDISHSCSVSYTAKEYIFL 150 +Q TN +++L+R S++ C+ S +EYI L Sbjct: 54 FQNTNTKSALRLVRESELLGGCTKSTVDREYITL 87
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 76 VQLIRLSD-ISHSCSVSYTAKEYIFLTEILKFRHPPKL 186 V+L RL D +C +SY ++ F+ E+L PPK+ Sbjct: 23 VELKRLKDAFKRTCGLSYYMGQHCFIREVLGDGVPPKV 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,899,295 Number of Sequences: 219361 Number of extensions: 854242 Number of successful extensions: 1783 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1783 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)