| Clone Name | rbart13h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HHCM_HUMAN (Q05877) Hepatocellular carcinoma protein HHCM (HHC(M)) | 32 | 0.45 | 2 | IF2P_METJA (Q57710) Probable translation initiation factor IF-2 ... | 29 | 3.8 | 3 | L1CAM_MOUSE (P11627) Neural cell adhesion molecule L1 precursor ... | 28 | 6.6 |
|---|
>HHCM_HUMAN (Q05877) Hepatocellular carcinoma protein HHCM (HHC(M))| Length = 467 Score = 32.3 bits (72), Expect = 0.45 Identities = 19/80 (23%), Positives = 37/80 (46%), Gaps = 7/80 (8%) Frame = +1 Query: 1 EKKWGMLSLYISFHAKTRNSNLFCCVC**QRDTYHMNINTNTLSSYSNIKMQ-------N 159 E W L ++ H + + +++ CC Q YH+N T +L+++ + Q N Sbjct: 301 ELMWKPQPLQVALHLQHKPNHINCCKTKLQHSPYHLN-KTQSLTTFKTPRTQSKITSTKN 359 Query: 160 ETKLRSQGSFLCVSSVCSIT 219 + L QG + V++ +T Sbjct: 360 QENLNEQGKWQSVAASAEMT 379
>IF2P_METJA (Q57710) Probable translation initiation factor IF-2 [Contains: Mja| infB intein (Mja IF2 intein)] Length = 1155 Score = 29.3 bits (64), Expect = 3.8 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 325 LVDSFFQKRNTFTCLIEIICVAFRSMRRILQEDAFELYYTQMI 197 L D F++++ C +E++C R +++ED +L Y + I Sbjct: 1031 LPDCIFRQKDPAICGVEVLCGTLRVGAPLMREDGMQLGYVREI 1073
>L1CAM_MOUSE (P11627) Neural cell adhesion molecule L1 precursor (N-CAM L1)| Length = 1260 Score = 28.5 bits (62), Expect = 6.6 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = -2 Query: 308 PETKY-FYLFD*DHMRCL*EHEENITRGCIRVILHTDDTHKNEPWDLSFVSFCILILLYD 132 P+TKY +L + L H + T G V + T + +E W ++FVS IL+LL Sbjct: 1084 PDTKYEIHLIK---EKVLLHHLDVKTNGTGPVRVSTTGSFASEGWFIAFVSAIILLLLI- 1139 Query: 131 DKVLVLIFI 105 +L+L FI Sbjct: 1140 --LLILCFI 1146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,033,044 Number of Sequences: 219361 Number of extensions: 822220 Number of successful extensions: 1931 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1931 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)