| Clone Name | rbart12a03 |
|---|---|
| Clone Library Name | barley_pub |
>YKJ4_YEAST (P28321) Hypothetical 35.5 kDa protein in CWP1-MBR1 intergenic| region Length = 313 Score = 45.8 bits (107), Expect = 6e-05 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = -2 Query: 481 VTDPSVSDLLFRSAVSQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQRS 317 + DP S+ + S DK+L LYPG H++ S E+ E + VF D+ WLD+ + Sbjct: 253 INDPKGSEKFIQDCPSADKELKLYPGARHSIFSLETDEVFNTVFNDMKQWLDKHT 307
>MGLL_HUMAN (Q99685) Monoglyceride lipase (EC 3.1.1.23) (MGL) (HU-K5)| (Lysophospholipase homolog) (Lysophospholipase-like) Length = 303 Score = 39.7 bits (91), Expect = 0.004 Identities = 22/56 (39%), Positives = 31/56 (55%) Frame = -2 Query: 484 KVTDPSVSDLLFRSAVSQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQRS 317 ++ D + LL A SQDK L +Y G +H L E PE + VF +I W+ QR+ Sbjct: 240 RLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHK-ELPEVTNSVFHEINMWVSQRT 294
>MGLL_RAT (Q8R431) Monoglyceride lipase (EC 3.1.1.23) (MGL)| Length = 303 Score = 36.6 bits (83), Expect = 0.036 Identities = 20/55 (36%), Positives = 29/55 (52%) Frame = -2 Query: 484 KVTDPSVSDLLFRSAVSQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQR 320 ++ D + LL S+ SQDK L +Y G +H L E PE + V +I W+ R Sbjct: 240 RLCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHK-ELPEVTNSVLHEINTWVSHR 293
>MGLL_MOUSE (O35678) Monoglyceride lipase (EC 3.1.1.23) (MGL)| Length = 303 Score = 35.8 bits (81), Expect = 0.062 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = -2 Query: 484 KVTDPSVSDLLFRSAVSQDKKLNLYPGMWHALTSGESPENIHIVFQDIIAWLDQR 320 ++ D + LL S+ SQDK L +Y G +H L E PE + V ++ +W+ R Sbjct: 240 RLCDSKGAYLLMESSRSQDKTLKMYEGAYHVL-HRELPEVTNSVLHEVNSWVSHR 293
>VE4_HPV57 (P22157) Probable protein E4| Length = 124 Score = 30.4 bits (67), Expect = 2.6 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 425 EAQPLPRHVARPHLRREPRKHPHRFP 348 + QP P+ +RPH R PR+H R P Sbjct: 47 QPQPQPQQQSRPHSRTPPRRHRVRHP 72
>PHLA1_HUMAN (Q8WV24) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Apoptosis-associated nuclear protein) (Proline- and histidine-rich protein) (Proline- and glutamine-rich protein) (PQ-rich protein) Length = 259 Score = 29.6 bits (65), Expect = 4.4 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -1 Query: 428 QEAQPLPRHVARPHLRREPRKHPHRFPRYHRVARPKVIP 312 Q+ P P PH HPH P H++ P P Sbjct: 204 QQLHPYPHPHPHPHSHPHSHPHPHPHPHPHQIPHPHPQP 242
>BARH1_DROAN (P22544) Homeobox protein B-H1 (Homeobox BarH1 protein)| Length = 606 Score = 29.6 bits (65), Expect = 4.4 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -1 Query: 422 AQPLPRHVARPHLRREPRKHPHRFPRYHRVARP 324 A P P H P P HPH P H + P Sbjct: 160 APPPPLHHLHPQSHPHPHPHPHSHPHPHALVHP 192
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 28.9 bits (63), Expect = 7.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -1 Query: 407 RHVARPHLRREPRKHPHRFPRYH 339 +H A PH + P HPH P H Sbjct: 211 QHPAHPHSHQHPHPHPHPHPHPH 233
>CREB5_HUMAN (Q02930) cAMP response element-binding protein 5 (CRE-BPa)| Length = 508 Score = 28.5 bits (62), Expect = 9.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 419 QPLPRHVARPHLRREPRKHPHRFPRYHR 336 Q LP H PH + P HPH P + + Sbjct: 282 QTLPPHHPYPHQHQHPAHHPHPQPHHQQ 309
>G6PI_BLOPB (Q491V0) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 551 Score = 28.5 bits (62), Expect = 9.9 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 4/84 (4%) Frame = -2 Query: 262 QKAKHDEQNFDKQNSTKAND--DEQL*AWLSTAGTWNHVS*LAGYPCGVLIHYCTNLLAS 89 Q KH +Q+FD ST ND ++ + + T+N+ +L+ Y NL+ + Sbjct: 10 QAWKHLKQHFDDMKSTSINDLFNQDKYRFAHFSKTFNNE---------ILVDYSKNLITN 60 Query: 88 SLVSVFLYTSIPCNL--DLSKIYH 23 + + +I C+L +S ++H Sbjct: 61 ETIIKLISLAIECDLIEAISDMFH 84
>CREB5_MOUSE (Q8K1L0) cAMP response element-binding protein 5 (CRE-BPa)| (Fragment) Length = 353 Score = 28.5 bits (62), Expect = 9.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 419 QPLPRHVARPHLRREPRKHPHRFPRYHR 336 Q LP H PH + P HPH P + + Sbjct: 127 QTLPPHHPYPHQHQHPAHHPHPQPHHQQ 154 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,762,275 Number of Sequences: 219361 Number of extensions: 1187465 Number of successful extensions: 3671 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3451 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3655 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)