| Clone Name | rbart10g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHF10_MOUSE (Q9D8M7) PHD finger protein 10 | 30 | 3.7 | 2 | YWBM_BACSU (P39596) Hypothetical protein ywbM | 29 | 6.3 |
|---|
>PHF10_MOUSE (Q9D8M7) PHD finger protein 10| Length = 410 Score = 30.0 bits (66), Expect = 3.7 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 312 GGQRKRSNKNCMSSSVNHYRLGRSPPSSPAQT*H 413 GG KR NK SS + G SPP S T H Sbjct: 220 GGDEKRKNKGTSDSSSGNVSEGDSPPDSQEDTFH 253
>YWBM_BACSU (P39596) Hypothetical protein ywbM| Length = 385 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +3 Query: 198 VSAVSGTTGLVQSGDIKASSTFYCGAR 278 V A TG V+SGDI+ S T Y AR Sbjct: 166 VKATEAFTGAVKSGDIEKSKTLYAKAR 192 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,160,413 Number of Sequences: 219361 Number of extensions: 1562507 Number of successful extensions: 4079 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4077 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)