| Clone Name | rbart09e08 |
|---|---|
| Clone Library Name | barley_pub |
>SECA_GUITH (O78441) Preprotein translocase secA subunit| Length = 877 Score = 30.4 bits (67), Expect = 2.3 Identities = 26/65 (40%), Positives = 33/65 (50%) Frame = +3 Query: 6 NRDGPVLIRTTSDYQTKLLEKHSCPYNLPTLTNKLTHKPQW*CNVEYEAKIKVGNGRALH 185 N PVLI TTS +++LL Y +P N L KP+ NV+ EA+I GR Sbjct: 424 NLGRPVLIGTTSVEKSELLSSLLKEYGVP--HNLLNAKPE---NVQREAEIVAQAGRLGA 478 Query: 186 VTHRT 200 VT T Sbjct: 479 VTIAT 483
>YJA1_SCHPO (Q9USN4) Putative transporter C1529.01| Length = 462 Score = 30.4 bits (67), Expect = 2.3 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -2 Query: 205 CCVRCVTWSALPFPTFIFASYSTLHYHWGLCVSLFVRV 92 CCVR + +A FP F Y TL Y WG + F+ V Sbjct: 426 CCVRSI--AAFAFPLFGQDMYDTLGYGWGNSLLAFMYV 461
>RBL2_RAT (O55081) Retinoblastoma-like protein 2 (130 kDa| retinoblastoma-associated protein) (PRB2) (P130) (RBR-2) (PPAR-alpha-interacting complex protein 128) (PRIC128) Length = 1135 Score = 29.6 bits (65), Expect = 3.9 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 214 LLICCVRCVTWSALP---FPTFIFASYSTLHYHWGLCVSLFVR 95 LL CC+ V +S P FP FI + HYH+ + +F+R Sbjct: 529 LLACCLEVVAFSYKPPGNFP-FIAEIFDVPHYHFYKVIEVFIR 570
>RBL2_MOUSE (Q64700) Retinoblastoma-like protein 2 (130 kDa| retinoblastoma-associated protein) (PRB2) (P130) (RBR-2) Length = 1135 Score = 29.6 bits (65), Expect = 3.9 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = -2 Query: 214 LLICCVRCVTWSALP---FPTFIFASYSTLHYHWGLCVSLFVR 95 LL CC+ V +S P FP FI + HYH+ + +F+R Sbjct: 529 LLACCLEVVAFSHKPPGNFP-FIAEIFDVPHYHFYKVIEVFIR 570
>PALI_YARLI (Q7Z8R5) pH-response regulator protein palI/RIM9| Length = 728 Score = 28.9 bits (63), Expect = 6.7 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 13/79 (16%) Frame = -1 Query: 239 PAAG*FTLVINLLCAMRDVERSAIS--YLYFCFVFHITLPLGFMC*FICE---------- 96 P A FTL++ +L + ++ A S YL FC VF + L + F+ + Sbjct: 93 PIATGFTLILTVLAMLAHIQGPASSSRYLLFCLVFSLPTFLLVLLSFLVDILLFVPHLDW 152 Query: 95 -GWEIIRAAVFF**LGLVI 42 GW ++ A + G+V+ Sbjct: 153 GGWIVLAATILVAISGVVL 171
>MRGRE_MOUSE (Q91ZB7) Mas-related G-protein coupled receptor member E| (Evolutionary breakpoint transcript 3 protein) Length = 310 Score = 28.5 bits (62), Expect = 8.7 Identities = 24/83 (28%), Positives = 30/83 (36%), Gaps = 21/83 (25%) Frame = -2 Query: 232 LVDLLWLLI-------CCVRCVTWSAL--------------PFPTFIFASYSTLHYHWGL 116 L D+LWL++ CC CVT L FPT + L Sbjct: 169 LCDMLWLVVAVLLAALCCTMCVTSLLLLLRVERGPERHQPRGFPTLVL-----------L 217 Query: 115 CVSLFVRVGRLYGQLCFSNNLVW 47 V LF+ G +G S NL W Sbjct: 218 AVLLFLFCGLPFGIFWLSKNLSW 240
>GPR88_HUMAN (Q9GZN0) Probable G-protein coupled receptor 88 (Striatum-specific| G-protein coupled receptor) Length = 384 Score = 28.5 bits (62), Expect = 8.7 Identities = 20/53 (37%), Positives = 25/53 (47%) Frame = -2 Query: 274 PPEPILDRRTAGRRLVDLLWLLICCVRCVTWSALPFPTFIFASYSTLHYHWGL 116 P P L R A RRL L LL+CCV + + P AS +L WG+ Sbjct: 267 PLPPALHPRRAQRRLSGLSVLLLCCVFLL--ATQPLVWVSLASGFSLPVPWGV 317 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,752,218 Number of Sequences: 219361 Number of extensions: 918473 Number of successful extensions: 3007 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2958 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)