| Clone Name | rbart09a06 |
|---|---|
| Clone Library Name | barley_pub |
>VHSJ_LAMBD (P03749) Host specificity protein J| Length = 1132 Score = 30.8 bits (68), Expect = 1.7 Identities = 21/76 (27%), Positives = 34/76 (44%), Gaps = 7/76 (9%) Frame = +3 Query: 189 GRKRLLLGRTLY-MCTQSILISGSCLRNELAGFQLLGFCSAPD------DAPTDVTKLQT 347 G KR + GRT Y MC +L++G+ + + A + F D + T T Sbjct: 1043 GSKRTVSGRTTYSMCYLKVLMNGAVIYDGAANEAVQVFSRIVDMPAGRGNVILTFTLTST 1102 Query: 348 AHLTDLAPYWYMSSIR 395 H D+ PY + S ++ Sbjct: 1103 RHSADIPPYTFASDVQ 1118
>PLEC1_RAT (P30427) Plectin-1 (PLTN) (PCN)| Length = 4687 Score = 30.0 bits (66), Expect = 2.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 443 PGNGSESGCACKLWELPNAAHVPVRRKVRQMCSLQ 339 PG GS G + LWE+ + +P ++ R M Q Sbjct: 3715 PGGGSHGGSSMSLWEVMQSDMIPEDQRARLMADFQ 3749
>PLEC1_CRIGR (Q9JI55) Plectin-1 (PLTN) (PCN) (300-kDa intermediate| filament-associated protein) (IFAP300) (Fragment) Length = 4473 Score = 30.0 bits (66), Expect = 2.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -2 Query: 443 PGNGSESGCACKLWELPNAAHVPVRRKVRQMCSLQ 339 PG GS G + LWE+ + +P ++ R M Q Sbjct: 3501 PGGGSHGGSSMSLWEVMQSDMIPEDQRARLMADFQ 3535
>ABCA1_HUMAN (O95477) ATP-binding cassette sub-family A member 1 (ATP-binding| cassette transporter 1) (ATP-binding cassette 1) (ABC-1) (Cholesterol efflux regulatory protein) Length = 2261 Score = 28.9 bits (63), Expect = 6.3 Identities = 17/36 (47%), Positives = 19/36 (52%) Frame = +1 Query: 61 GGFVYLSDPVTQMIRRILSNYVLPKTLVYSASSPGP 168 GGF YL D V Q I R+L+ KT VY P P Sbjct: 591 GGFAYLQDVVEQAIIRVLTG-TEKKTGVYMQQMPYP 625
>PLEC1_HUMAN (Q15149) Plectin-1 (PLTN) (PCN) (Hemidesmosomal protein 1) (HD1)| Length = 4684 Score = 28.5 bits (62), Expect = 8.2 Identities = 11/35 (31%), Positives = 17/35 (48%) Frame = -2 Query: 443 PGNGSESGCACKLWELPNAAHVPVRRKVRQMCSLQ 339 PG GS G LWE+ + +P ++ + M Q Sbjct: 3712 PGGGSHGGSTMSLWEVMQSDLIPEEQRAQLMADFQ 3746
>MYC1_XENLA (P06171) Myc-A protein (Myc I protein) (C-Myc I)| Length = 419 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/52 (30%), Positives = 26/52 (50%) Frame = -2 Query: 347 SLQFRDISWGIIGCRAEAQQLKSCKFITKAASRNKNALSAHV*SSSQKQPFP 192 S+ +D W A+ +++ S K + ASR ++ALS+ SQ P P Sbjct: 105 SIVIQDCMWSGFSAAAKLEKVVSEKLASYQASRKESALSSSSPCQSQPPPSP 156
>CLPX_STRMU (Q8DUI0) ATP-dependent Clp protease ATP-binding subunit clpX| Length = 410 Score = 28.5 bits (62), Expect = 8.2 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 174 GRNGEGRKRLLLGRTLYMCTQSILISGSCLRNELAGFQLLGFCSAP 311 G+N + K+++ G +++C + + +S +R ELA L P Sbjct: 17 GKNQDEVKKIIAGNGVFICNECVELSQEIIREELAEEVLADLSEVP 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 67,893,563 Number of Sequences: 219361 Number of extensions: 1380038 Number of successful extensions: 3909 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3907 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)