| Clone Name | rbart08c02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GTR5_RABIT (P46408) Solute carrier family 2, facilitated glucose... | 28 | 9.1 | 2 | PHLB_MYCTU (P95246) Phospholipase C 2 precursor (EC 3.1.4.3) | 28 | 9.1 |
|---|
>GTR5_RABIT (P46408) Solute carrier family 2, facilitated glucose transporter| member 5 (Glucose transporter type 5, small intestine) (Fructose transporter) Length = 486 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = -3 Query: 127 GLVRIR*GCCCYXMCWYIXHQVWDFWYKTCG*CCIYYYHLVF 2 GLV +R C + W + V W + G IYYY ++ Sbjct: 258 GLVSVRALCAMRGLAWQLISVVPLMWQQLSGVNAIYYYDQIY 299
>PHLB_MYCTU (P95246) Phospholipase C 2 precursor (EC 3.1.4.3)| Length = 521 Score = 27.7 bits (60), Expect = 9.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +2 Query: 47 IPKIPHLMXNIPTHTVAATALPYSYQSPLSL 139 +PK+P + N TV TA+PY P S+ Sbjct: 475 LPKLPQCVPNAVLGTVTKTAIPYRVPFPQSM 505 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.310 0.130 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,708,635 Number of Sequences: 219361 Number of extensions: 251521 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)