| Clone Name | rbart07e02 |
|---|---|
| Clone Library Name | barley_pub |
>CUTI_PHYCP (P41754) Putative cutinase (EC 3.1.1.74) (Cutin hydrolase)| Length = 210 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -2 Query: 218 YASSLSKIYGEVSSVDQFVTSLCFXLFPRFLCVYSSCKMLGSLCG-RIKPYYKTYPLWAT 42 ++ +S + S Q S C L P F+ +YS+ +L +L + PY T PL Sbjct: 112 FSPCISGVANSQHSSSQSPRSHCRSLVPSFIAIYSASVVLCALISCFLDPYETTLPLTNV 171 Query: 41 *GC 33 C Sbjct: 172 TNC 174
>PRKDC_HUMAN (P78527) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) (DNPK1) (p460) Length = 4128 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = -3 Query: 145 TYFPDFCVCTPHVKCWAACVVALNPIIKLIRCGQHRDAKDGIKLID 8 ++FP F C + C A +++L+P C GI+L++ Sbjct: 2849 SFFPPFVSCIQDISCQHAALLSLDPAAVSAGCLASLQQPVGIRLLE 2894
>HST1_YEAST (P53685) NAD-dependent deacetylase HST1 (EC 3.5.1.-) (Homologous to| SIR2 protein 1) Length = 503 Score = 27.3 bits (59), Expect = 9.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 272 CHWDTSHRRREDLNMIPRYASSLSK 198 CHWD H++ +DL I + + K Sbjct: 465 CHWDIPHKKWQDLKKIDYNCTEIDK 489
>STUB_DROME (Q05319) Serine proteinase stubble (EC 3.4.21.-) (Protein| stubble-stubbloid) [Contains: Serine proteinase stubble non-catalytic chain; Serine proteinase stubble catalytic chain] Length = 787 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 6 QSXSFIPSFASLCCPQRISFIIGFNAT 86 Q F P + +C P+ S +IG NAT Sbjct: 648 QPLEFAPHVSPICLPETDSLLIGMNAT 674
>TAH18_YEAST (Q12181) Probable NADPH reductase TAH18 (EC 1.-.-.-)| Length = 623 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/55 (25%), Positives = 22/55 (40%) Frame = +2 Query: 80 CDHTSCPTFYMRSTHTKIWEIGXNINSLQTGQRKILHHRSYSASLHTSESYSDLH 244 CD S P S KIW ++ ++ GQ ++ R T + DL+ Sbjct: 325 CDFMSIPR---TSFFLKIWTFATDVTKMERGQEQLNDQREKLRQFATDQDMQDLY 376
>PURA_BRUSU (P65879) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 83 RIKPYYKTYPLWA--T*GCKGWN 21 R+KP Y+T P W+ T G + WN Sbjct: 365 RVKPIYETLPGWSETTAGARSWN 387
>PURA_BRUME (P65878) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 83 RIKPYYKTYPLWA--T*GCKGWN 21 R+KP Y+T P W+ T G + WN Sbjct: 365 RVKPIYETLPGWSETTAGARSWN 387
>PURA_BRUAB (P0C115) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 83 RIKPYYKTYPLWA--T*GCKGWN 21 R+KP Y+T P W+ T G + WN Sbjct: 365 RVKPIYETLPGWSETTAGARSWN 387
>PURA_BRUA2 (Q2YQI5) Adenylosuccinate synthetase (EC 6.3.4.4) (IMP--aspartate| ligase) (AdSS) (AMPSase) Length = 429 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%) Frame = -2 Query: 83 RIKPYYKTYPLWA--T*GCKGWN 21 R+KP Y+T P W+ T G + WN Sbjct: 365 RVKPIYETLPGWSETTAGARSWN 387
>P2Y10_HUMAN (O00398) Putative P2Y purinoceptor 10 (P2Y10) (P2Y-like receptor)| Length = 339 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -3 Query: 196 SMVKYLPLTSL*RVYVXTYFPDFCVCTPHVKCWAACVVALNPIIKLIRCGQHRD 35 +MVK ++S V + YF FC+C + C L+PI+ + RD Sbjct: 267 TMVKETIISSCPVVRIALYFHPFCLCLASLCC------LLDPILYYFMASEFRD 314
>JHD2C_MOUSE (Q69ZK6) Probable JmjC domain-containing histone demethylation| protein 2C (EC 1.14.11.-) (Jumonji domain-containing protein 1C) Length = 2350 Score = 27.3 bits (59), Expect = 9.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 320 HEDQAQRLHGKIP*HLCHWDTSH 252 H+ +++ L GKIP HL H SH Sbjct: 963 HQPESESLVGKIPDHLPHQSASH 985 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,619,940 Number of Sequences: 219361 Number of extensions: 1048038 Number of successful extensions: 2086 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2086 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)