| Clone Name | rbart07d11 |
|---|---|
| Clone Library Name | barley_pub |
>PSD4_ARATH (P55034) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) Length = 386 Score = 51.6 bits (122), Expect = 8e-07 Identities = 26/51 (50%), Positives = 39/51 (76%), Gaps = 1/51 (1%) Frame = -3 Query: 369 LQMSVQDAEASGQFDM-SKVFEDRSFVTSILNSLPGVDPNDPSVKDLLASL 220 LQMS+ E+S + + +++F++S+L+SLPGVDPNDP+VK+LLASL Sbjct: 314 LQMSMSGEESSEATGAGNNLLGNQAFISSVLSSLPGVDPNDPAVKELLASL 364
>PSD4_HUMAN (P55036) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) (Antisecretory factor 1) (AF) (ASF) Length = 377 Score = 40.4 bits (93), Expect = 0.002 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 19/72 (26%) Frame = -3 Query: 369 LQMSVQDAE----------ASGQFDMSK---------VFEDRSFVTSILNSLPGVDPNDP 247 +QMS+Q AE AS D S+ V +D F+ S+L +LPGVDPN+ Sbjct: 291 MQMSLQGAEFGQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNE 350 Query: 246 SVKDLLASLHGQ 211 ++++ + SL Q Sbjct: 351 AIRNAMGSLASQ 362
>PSD4_DROME (P55035) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein) (54 kDa subunit of mu particle) (p54) Length = 396 Score = 40.0 bits (92), Expect = 0.002 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 19/70 (27%) Frame = -3 Query: 369 LQMSVQDA---------------EASGQFDM----SKVFEDRSFVTSILNSLPGVDPNDP 247 +QMS+QDA EA+ D+ S+V D +F+ S+L +LPGVDP Sbjct: 312 MQMSMQDAPDDSVTQQAKRPKTDEANAPMDVDEDYSEVIGDPAFLQSVLENLPGVDPQSE 371 Query: 246 SVKDLLASLH 217 +V+D + SL+ Sbjct: 372 AVRDAVGSLN 381
>PSD4_MOUSE (O35226) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) (Rpn10) (Multiubiquitin chain-binding protein) Length = 376 Score = 38.9 bits (89), Expect = 0.005 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 18/71 (25%) Frame = -3 Query: 369 LQMSVQ---------DAEASGQFDMSK---------VFEDRSFVTSILNSLPGVDPNDPS 244 +QMS+Q D +AS D S V +D F+ S+L +LPGVDPN+ + Sbjct: 291 MQMSLQGTEFSQESADMDASSAMDTSDPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNAA 350 Query: 243 VKDLLASLHGQ 211 ++ ++ +L Q Sbjct: 351 IRSVMGALASQ 361
>PSD4_SCHMA (O17453) 26S proteasome non-ATPase regulatory subunit 4 (26S| proteasome regulatory subunit S5A) Length = 420 Score = 28.9 bits (63), Expect = 5.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 315 VFEDRSFVTSILNSLPGVDPNDPSVKDLLASL 220 V D F+ S+L SLPGVD + V+ + +L Sbjct: 367 VMYDAEFLESVLQSLPGVDTQNEDVRKAINAL 398
>ATG3_KLULA (Q6CL19) Autophagy-related protein 3 (Autophagy-related E2-like| conjugation enzyme ATG3) Length = 302 Score = 28.5 bits (62), Expect = 7.1 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 315 LCSYQIDQTPLRPEQTFEE 371 LC Y D TPL P+Q FE+ Sbjct: 182 LCGYDNDGTPLSPDQMFED 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,818,211 Number of Sequences: 219361 Number of extensions: 832816 Number of successful extensions: 1904 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1848 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1904 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)