| Clone Name | rbart06h11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protei... | 28 | 7.4 |
|---|
>DCR1_DROME (Q9VCU9) Endoribonuclease Dcr-1 (EC 3.1.26.-) (Protein dicer-1)| Length = 2249 Score = 28.5 bits (62), Expect = 7.4 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = +1 Query: 1 TQNPLSI*PKWSGNSRTVQSGSRTCTKPTTTRRSSKEKRDGTDNQCIIVH 150 T P PK S + T Q +R + TRR ++ DG+D C +++ Sbjct: 452 TPTPAHAKPKPSSGANTAQPRTR---RRVYTRRHHRDHNDGSDTLCALIY 498 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,658,520 Number of Sequences: 219361 Number of extensions: 656251 Number of successful extensions: 1744 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1744 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)