| Clone Name | rbaet99g06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SIR2_CANGA (Q6FWI7) NAD-dependent histone deacetylase SIR2 (EC 3... | 28 | 6.9 |
|---|
>SIR2_CANGA (Q6FWI7) NAD-dependent histone deacetylase SIR2 (EC 3.5.1.-)| (Regulatory protein SIR2) (Silent information regulator 2) Length = 509 Score = 28.1 bits (61), Expect = 6.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 153 APLASGVGMIYIYM-SVKYMQDSVQHIQDDTFASGFCNRMLSLSSQCFRW 7 AP++ V MI Y+ V +D V+H + D GFC+ + ++ +Q W Sbjct: 426 APVSEIVNMIPAYVPQVLINKDPVKHAEFDIELLGFCDDVATVVAQKCEW 475 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,297,484 Number of Sequences: 219361 Number of extensions: 383369 Number of successful extensions: 1029 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)