| Clone Name | rbaet99f06 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC3_MOUSE (Q61982) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2318 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 Query: 127 SCYCSVNRPSSL*SLPCNSIPCIPFKSCLVISSLNKHRWFC 5 SC S PS + C S PC+ SCL + S+ R C Sbjct: 1324 SCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVC 1364
>GLPF_MYCGE (P47279) Probable glycerol uptake facilitator protein| Length = 258 Score = 27.7 bits (60), Expect = 7.1 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +2 Query: 194 GWWLLHEMVGTFQTVV-GDG 250 GWW L E++GTF ++ G+G Sbjct: 10 GWWFLAELIGTFILIIFGNG 29
>ADFP_MOUSE (P43883) Adipophilin (Adipose differentiation-related protein)| (ADRP) Length = 425 Score = 27.7 bits (60), Expect = 7.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -2 Query: 301 QYPTLVSVCYQASKHLRTITNHCLKGA 221 QYP L SVC A K ++T+T+ + A Sbjct: 39 QYPYLRSVCEMAEKGVKTVTSAAMTSA 65
>NFYA7_ARATH (Q84JP1) Nuclear transcription factor Y subunit A-7 (AtNF-YA-7)| Length = 190 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +3 Query: 72 ELHGRLYRLDGRLTLQ*QDKQAKNRRP*VHHSQ 170 + HG L R R L+ Q+K K+R+P +H S+ Sbjct: 108 QYHGILRRRQSRARLESQNKVIKSRKPYLHESR 140
>NOTC3_RAT (Q9R172) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2319 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = -2 Query: 127 SCYCSVNRPSSL*SLPCNSIPCIPFKSCLVISSLNKHRWFC 5 SC S PS + C + PC+ SCL + S+ R C Sbjct: 1325 SCRVSRASPSGATNTSCAATPCLHGGSCLPVQSVPFFRCVC 1365
>AROK_CHLMU (Q9PK27) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 184 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 6/47 (12%) Frame = -2 Query: 358 VVVLDFPFVVA------KPAPSA*TQYPTLVSVCYQASKHLRTITNH 236 +V+LD PF KP P + P+L + +Q + LR +T H Sbjct: 105 LVLLDLPFATLYQRLQKKPLPESLKNTPSLENALFQRLEKLRLLTPH 151
>SYD_THEAC (Q9HJM1) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 428 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 163 IHSCSLQIDRWMVAIT*NGRHLSDSGW*WYVDAYLLGNRQIPGWGTGFKRM 315 +H + I R+ N + L + +YVDA+ G GWG G +R+ Sbjct: 359 VHDPKMLIQRF------NEKKLDVKSFQFYVDAFKYGMPPHAGWGLGLERL 403 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,329,226 Number of Sequences: 219361 Number of extensions: 900230 Number of successful extensions: 1872 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1872 length of database: 80,573,946 effective HSP length: 99 effective length of database: 58,857,207 effective search space used: 1412572968 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)