| Clone Name | rbaet99d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YGBL_ECOLI (Q46890) Putative aldolase class 2 protein ygbL | 31 | 0.70 | 2 | EVL_MOUSE (P70429) Ena/VASP-like protein (Ena/vasodilator stimul... | 28 | 7.7 | 3 | EVL_RAT (O08719) Ena/VASP-like protein (Ena/vasodilator stimulat... | 28 | 7.7 |
|---|
>YGBL_ECOLI (Q46890) Putative aldolase class 2 protein ygbL| Length = 212 Score = 31.2 bits (69), Expect = 0.70 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = -1 Query: 293 GRLLGSAHGRRLCSVRAELKVSNGQKPRRSVILQARSYL*SPACNPIVIHLSS 135 G LG+ +RL V A+ + +G KP + V+ Y +P C V+HL S Sbjct: 50 GSCLGNLDPQRLSKVAADGEWLSGDKPSKEVLFHLALYRNNPRCK-AVVHLHS 101
>EVL_MOUSE (P70429) Ena/VASP-like protein (Ena/vasodilator stimulated| phosphoprotein-like) Length = 414 Score = 27.7 bits (60), Expect = 7.7 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = -3 Query: 291 PTTGFSTWPPPLFRQGGAEGFERPKTAAIG---NFAG*KLPMIPSLQSYSDSSQ*RYMST 121 P TG + PPP GGA+G +++A G AG KL + + S S S Sbjct: 191 PPTGSTPPPPPPLPAGGAQGTNHDESSASGLAAALAGAKLRRVQRPEDASGGSSPSGTSK 250 Query: 120 VDTPR 106 D R Sbjct: 251 SDANR 255
>EVL_RAT (O08719) Ena/VASP-like protein (Ena/vasodilator stimulated| phosphoprotein-like) Length = 393 Score = 27.7 bits (60), Expect = 7.7 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = -3 Query: 291 PTTGFSTWPPPLFRQGGAEGFERPKTAAIG---NFAG*KLPMIPSLQSYSDSSQ*RYMST 121 P TG + PPP GGA+G +++A G AG KL + + S S S Sbjct: 191 PPTGSTPPPPPPLPAGGAQGTNHDESSASGLAAALAGAKLRRVQRPEDASGGSSPSGTSK 250 Query: 120 VDTPR 106 D R Sbjct: 251 SDANR 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,151,239 Number of Sequences: 219361 Number of extensions: 726729 Number of successful extensions: 1313 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1313 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)