| Clone Name | rbaet99d02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ZN655_HUMAN (Q8N720) Zinc finger protein 655 (Vav-interacting Kr... | 30 | 1.7 | 2 | ZN287_HUMAN (Q9HBT7) Zinc finger protein 287 | 30 | 2.2 | 3 | ZN287_MOUSE (Q9EQB9) Zinc finger protein 287 (Zfp-287) (Zinc fin... | 28 | 6.3 | 4 | ZFP62_MOUSE (Q8C827) Zinc finger protein 62 homolog (Zfp-62) (ZT3) | 28 | 6.3 | 5 | PP11_HUMAN (P21128) Placental protein 11 precursor (EC 3.4.21.-)... | 28 | 8.2 |
|---|
>ZN655_HUMAN (Q8N720) Zinc finger protein 655 (Vav-interacting Kruppel-like| protein) Length = 491 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = +2 Query: 83 QCDVVGVKSHKWSALVPHRSQHSREKKMK 169 +CDV G H+ SAL H+ H+REK K Sbjct: 213 KCDVCGKIFHQSSALTRHQRIHTREKPYK 241
>ZN287_HUMAN (Q9HBT7) Zinc finger protein 287| Length = 754 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +2 Query: 83 QCDVVGVKSHKWSALVPHRSQHSREK 160 +C+V G K K+ +L+ H+S H++EK Sbjct: 362 KCNVCGKKFRKYPSLLKHQSTHAKEK 387
>ZN287_MOUSE (Q9EQB9) Zinc finger protein 287 (Zfp-287) (Zinc finger protein| SKAT-2) Length = 759 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 86 CDVVGVKSHKWSALVPHRSQHSREK 160 C+V G + K+ +L+ HR H++EK Sbjct: 368 CNVCGKQFRKYPSLLAHRENHAKEK 392
>ZFP62_MOUSE (Q8C827) Zinc finger protein 62 homolog (Zfp-62) (ZT3)| Length = 914 Score = 28.1 bits (61), Expect = 6.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 83 QCDVVGVKSHKWSALVPHRSQHSREKKMK 169 +CD G +S+L+ H+S HS EK K Sbjct: 188 KCDECGKAYMSYSSLINHKSTHSGEKNCK 216
>PP11_HUMAN (P21128) Placental protein 11 precursor (EC 3.4.21.-) (PP11)| Length = 369 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +2 Query: 86 CDVVGVKSHKWSALVPHRSQHSREKKMKNLFHIDVQCEGR 205 C + + HK S +P + + E NL+ C+GR Sbjct: 13 CGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTSCQGR 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,792,850 Number of Sequences: 219361 Number of extensions: 615114 Number of successful extensions: 1552 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1552 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)