| Clone Name | rbaet99c12 |
|---|---|
| Clone Library Name | barley_pub |
>BACC_BACLI (O68008) Bacitracin synthetase 3 (BA3) [Includes: ATP-dependent| isoleucine adenylase (IleA) (Isoleucine activase); ATP-dependent D-phenylalanine adenylase (D-PheA) (D-phenylalanine activase); ATP-dependent histidine adenylase (HisA) (Histidine Length = 6359 Score = 29.6 bits (65), Expect = 2.1 Identities = 14/55 (25%), Positives = 28/55 (50%) Frame = +1 Query: 118 VHKLLAHFVQVITDFTLWQNAHVDQTEDGQSLSRHLALTRQNEGSSELARRRALC 282 V ++ AHFV+V+ D + + +DQ E ++ L R N+ ++ + +C Sbjct: 1445 VERMAAHFVRVLEDISKRTDKRLDQIEAMSEDEKNTLLYRFNDTKTDAPTDKTIC 1499
>COLX_ARATH (Q9C9F4) Putative zinc finger protein At1g68190| Length = 356 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -1 Query: 182 CAFCHSVKSVITCTKWASNLC-TYDAQAH 99 C FC + ++V+ C +NLC T DA+ H Sbjct: 14 CEFCKAYRAVVYCIADTANLCLTCDAKVH 42
>UBP53_MOUSE (P15975) Inactive ubiquitin carboxyl-terminal hydrolase 53| (Ubiquitin-specific peptidase 53) (Per-hexamer repeat protein 3) Length = 1069 Score = 28.5 bits (62), Expect = 4.6 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 8/63 (12%) Frame = +1 Query: 118 VHKLLAHFVQVITDFTLWQNAHVDQTED-GQSLSRHLAL-------TRQNEGSSELARRR 273 + ++L + +++T +W + H D TED +SL+ HL L T +N SEL Sbjct: 234 IRRVLMNCPEIVTIGLVWDSEHSDLTEDVVRSLATHLYLPGLFYRVTDENATDSELHLVG 293 Query: 274 ALC 282 +C Sbjct: 294 MIC 296
>COG1_DROME (Q9VGC3) Putative conserved oligomeric Golgi complex component 1| Length = 886 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +1 Query: 106 CASYVHKLLAHFVQVITDFTLWQNAHVDQTEDGQSLS 216 C + K++ H V V++DF LWQ ++Q ++ Q S Sbjct: 607 CEEKLPKVINHEV-VLSDFALWQTLTLEQRDEDQEQS 642
>MENE_STAEQ (Q5HNB2) 2-succinylbenzoate--CoA ligase (EC 6.2.1.26) (OSB-CoA| synthetase) (o-succinylbenzoyl-CoA synthetase) Length = 474 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/52 (26%), Positives = 25/52 (48%) Frame = +3 Query: 78 QELNHHGMSLCIIRTQVASPLRTSYHRFHTVAERTCRPNRRRSKLIATPRVD 233 ++ +G L I+ Q++ YHR T+AE N++R L + +D Sbjct: 7 EQAQSNGNRLAIVTNQLSLTYEELYHRAKTIAEYLTSLNQKRIGLYISNDID 58 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,735,356 Number of Sequences: 219361 Number of extensions: 657882 Number of successful extensions: 1570 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1551 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1570 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)