| Clone Name | rbaet99c08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YNL6_YEAST (P53924) RING finger protein YNL116W | 28 | 5.7 | 2 | LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-bind... | 28 | 7.5 | 3 | HUNB_DROTA (O46260) Protein hunchback (Fragments) | 28 | 7.5 | 4 | CI041_MOUSE (Q80UY1) Protein C9orf41 homolog | 28 | 7.5 |
|---|
>YNL6_YEAST (P53924) RING finger protein YNL116W| Length = 522 Score = 28.1 bits (61), Expect = 5.7 Identities = 10/31 (32%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -1 Query: 100 CALPPTDSVYGVPCI-TWHYLCVTKIPNQSY 11 C + P +++ PC +WH+ CV ++ SY Sbjct: 438 CKIKPCQAIFISPCAHSWHFRCVRRLVMLSY 468
>LTBP3_MOUSE (Q61810) Latent transforming growth factor beta-binding protein 3| precursor (LTBP-3) Length = 1268 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = -3 Query: 197 ITELEMPSVWCHMWGRRLAS*TCVGNVGSMVCMCSPAH 84 I E MP CH C+ N GS C+C P H Sbjct: 353 INECAMPGNVCHG--------DCLNNPGSYRCVCPPGH 382
>HUNB_DROTA (O46260) Protein hunchback (Fragments)| Length = 192 Score = 27.7 bits (60), Expect = 7.5 Identities = 17/74 (22%), Positives = 29/74 (39%) Frame = +3 Query: 78 ESVGGRAHANHASYISHTCSRR*TTTPHMTPDRRHLKLRDPTQNTKNKIRQMISINRVMN 257 E + H +HA + H S ++PH +P L +P NT ++ Q + + Sbjct: 13 EPISHHHHHHHAHHSHHADSNSNASSPHQSP----LPSPNPPSNTNLQLEQYLKQQQQQQ 68 Query: 258 CNQQRGQSACMHAC 299 Q+ Q C Sbjct: 69 QQHQQQQQPMDTLC 82
>CI041_MOUSE (Q80UY1) Protein C9orf41 homolog| Length = 400 Score = 27.7 bits (60), Expect = 7.5 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +1 Query: 43 GSAMLCMVHRTQSQWAG--EHMQTMLPTFPTHVHDARR 150 G++M V+RT+ Q+ E+ Q +LP FP H+ R+ Sbjct: 68 GTSMHERVNRTERQFRSLPENQQKLLPQFPLHLDKIRK 105 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,763,949 Number of Sequences: 219361 Number of extensions: 978682 Number of successful extensions: 2912 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2660 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2911 length of database: 80,573,946 effective HSP length: 84 effective length of database: 62,147,622 effective search space used: 1491542928 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)