| Clone Name | rbaet99c06 |
|---|---|
| Clone Library Name | barley_pub |
>G6PI_TREPA (O83488) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 535 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 118 VLVFDDGGLFRDLSNESLYLYILLSVGLEDHTWFLRLLS 2 +LV G LSNE ++L GLE HT F+ + S Sbjct: 211 ILVSKSGTTLETLSNELFVAHVLRQAGLEPHTQFVAVTS 249
>ASSY_SULAC (Q4J8F1) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 391 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 156 NSKELGRRGEFTPMGTDLTSYN 221 N K LGR+G+F+P ++ SYN Sbjct: 340 NMKILGRKGKFSPFSEEIASYN 361
>KAT3_ARATH (P92960) Potassium channel KAT3 (AKT4) (AtKC1) (Potassium channel| TKC) Length = 662 Score = 29.3 bits (64), Expect = 2.8 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +2 Query: 59 QVQRLI-AKITEQSSIIEHQNTTLSHNRNGRLSQQQRVGEERRVYTHG 199 QVQ + ++ T QS+ + + T+S + NG++ +++R G +RV HG Sbjct: 551 QVQETVQSEETPQSN--DEEIVTVSRHENGQIEERRREGVPKRVIIHG 596
>DOF53_ARATH (Q84TE9) Dof zinc finger protein DOF5.3 (AtDOF5.3)| Length = 257 Score = 28.9 bits (63), Expect = 3.7 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +3 Query: 30 SSNPT--DNNMYKYNDSLLRSRNNPPSSNTKTPRCLTTEMAGC 152 SSNPT DN+ K + + +R PP + PRC +T C Sbjct: 26 SSNPTPLDNDQKKPSPATAVTRPQPPELALRCPRCDSTNTKFC 68
>CYAA_DICDI (Q03100) Adenylate cyclase, aggregation specific (EC 4.6.1.1) (ATP| pyrophosphate-lyase) (Adenylyl cyclase) Length = 1407 Score = 28.1 bits (61), Expect = 6.3 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 3 DRRRRNHV*SSNPTDNNMYKYNDSLLRSRNNPPSSNT 113 D + N+ ++N NN +K ++++ + NN S+NT Sbjct: 531 DNKDNNNNNNNNKNSNNNFKNKNNIINNNNNSNSNNT 567
>CL190_DROME (Q9VJE5) Restin homolog (Cytoplasmic linker protein 190)| (Microtubule-binding protein 190) (d-CLIP-190) Length = 1690 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +2 Query: 62 VQRLIAKITEQSSIIEHQNTTLSHN 136 VQ L K+ E SSIIE QNT L+ + Sbjct: 1240 VQNLEEKVRESSSIIEAQNTKLNES 1264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,420,915 Number of Sequences: 219361 Number of extensions: 599230 Number of successful extensions: 2332 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2326 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)