| Clone Name | rbaet99b02 |
|---|---|
| Clone Library Name | barley_pub |
>PSTB1_VIBVY (Q7MNI7) Phosphate import ATP-binding protein pstB 1 (EC 3.6.3.27)| (Phosphate-transporting ATPase 1) (ABC phosphate transporter 1) Length = 272 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 11/52 (21%) Frame = -2 Query: 222 GAGTGSLIRCVNRCVFVLSSPKIRG-----------PCYSVRKIRRAVSFVF 100 G G +L+RC+NR ++ K+ G P V +RR V VF Sbjct: 61 GCGKSTLLRCINRMNDLVEGCKVTGSVKLYGSNVYDPSVDVATLRRRVGMVF 112
>PSTB1_VIBVU (Q8DEW5) Phosphate import ATP-binding protein pstB 1 (EC 3.6.3.27)| (Phosphate-transporting ATPase 1) (ABC phosphate transporter 1) Length = 272 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/52 (30%), Positives = 23/52 (44%), Gaps = 11/52 (21%) Frame = -2 Query: 222 GAGTGSLIRCVNRCVFVLSSPKIRG-----------PCYSVRKIRRAVSFVF 100 G G +L+RC+NR ++ K+ G P V +RR V VF Sbjct: 61 GCGKSTLLRCINRMNDLVEGCKVTGSVKLYGSNVYDPSVDVATLRRRVGMVF 112
>GLNQ_BACST (P27675) Glutamine transport ATP-binding protein glnQ| Length = 242 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/47 (25%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = -2 Query: 222 GAGTGSLIRCVNRC------VFVLSSPKIRGPCYSVRKIRRAVSFVF 100 G+G +L+RC+NR ++ + K+ + ++RR + VF Sbjct: 37 GSGKSTLVRCINRLETISSGELIVDNVKVNDKHIDINQLRRNIGMVF 83
>RR7_METGY (Q71L24) Chloroplast 30S ribosomal protein S7| Length = 155 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/39 (28%), Positives = 25/39 (64%) Frame = -1 Query: 163 SENSWPLLFSAENKKGRFIRIYYCCMSSRKKKGKDRNFQ 47 S +++ + +NK+G+ + I + SSRK+ G++ +F+ Sbjct: 81 SGSTYQVPIEIKNKEGKILAIRWLLESSRKRSGRNMHFK 119
>KCNT1_HUMAN (Q5JUK3) Potassium channel subfamily T member 1 (KCa4.1)| Length = 1230 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 150 HEFSENSAQKHTCSHTLSSCQCQRR 224 H S + ++K +CSH LSSC + R Sbjct: 1201 HVASSSQSRKSSCSHKLSSCNPETR 1225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,161,764 Number of Sequences: 219361 Number of extensions: 593349 Number of successful extensions: 1405 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1405 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)