| Clone Name | rbaet98h09 |
|---|---|
| Clone Library Name | barley_pub |
>RDRP_MRNV (Q6XNL5) RNA-directed RNA polymerase (EC 2.7.7.48) (RdRp) (RNA| replicase) Length = 1045 Score = 30.8 bits (68), Expect = 1.0 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = -3 Query: 156 SRSQVRWATEDEGLWCRSVWAWCRS**DHGEMEPLLYLRN 37 S +QV + + G W VW WC D+GE LYL+N Sbjct: 217 SDNQVDYRVDGGGRWQHKVWNWC----DYGE---FLYLKN 249
>MADCA_HUMAN (Q13477) Mucosal addressin cell adhesion molecule 1 precursor| (MAdCAM-1) (hMAdCAM-1) Length = 406 Score = 29.6 bits (65), Expect = 2.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 30 GFSFLNTREVPFLHDPISSYTKPTQIDTTSPHPP 131 G + + +P LH P T P DTTSP PP Sbjct: 212 GLELSHRQAIPVLHSP----TSPEPPDTTSPEPP 241
>YHBP_ECOL6 (Q8FD95) UPF0306 protein yhbP| Length = 140 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 183 LAAMRAWLASRSQVRWATEDEG-LWCRSVW 97 L A+ WLA + V W + EG LWC + + Sbjct: 4 LTAISRWLAKQHVVTWCVQQEGELWCANAF 33
>YHBP_ECO57 (Q8XA94) UPF0306 protein yhbP| Length = 147 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 183 LAAMRAWLASRSQVRWATEDEG-LWCRSVW 97 L A+ WLA + V W + EG LWC + + Sbjct: 4 LTAISRWLAKQHVVTWCVQQEGELWCANAF 33
>YHBP_SHIFL (P67763) UPF0306 protein yhbP| Length = 147 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 183 LAAMRAWLASRSQVRWATEDEG-LWCRSVW 97 L A+ WLA + V W + EG LWC + + Sbjct: 4 LIAISRWLAKQHVVTWCVQQEGELWCANAF 33
>YHBP_ECOLI (P67762) UPF0306 protein yhbP| Length = 147 Score = 28.9 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -3 Query: 183 LAAMRAWLASRSQVRWATEDEG-LWCRSVW 97 L A+ WLA + V W + EG LWC + + Sbjct: 4 LIAISRWLAKQHVVTWCVQQEGELWCANAF 33
>AGI_URTDI (P11218) Lectin/endochitinase precursor (EC 3.2.1.14) (Agglutinin)| (UDA) Length = 372 Score = 28.1 bits (61), Expect = 6.5 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 117 LWCRSVWAWCRS**DHGEMEP 55 LWC S+W WC G+ EP Sbjct: 38 LWCCSIWGWC------GDSEP 52
>PPZ1_YEAST (P26570) Serine/threonine-protein phosphatase PP-Z1 (EC 3.1.3.16)| Length = 691 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 89 HQAHTDRHHKPSSSVAH 139 H +HT+R+H PSSS +H Sbjct: 79 HSSHTNRYHFPSSSHSH 95
>YHBP_SALTY (P60822) UPF0306 protein yhbP| Length = 147 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 183 LAAMRAWLASRSQVRWATEDEG-LWCRSVW 97 L A+ WLA + V W EG LWC + + Sbjct: 4 LTAIGRWLAKQHVVTWCVHHEGELWCANAF 33
>YHBP_SALTI (P60821) UPF0306 protein yhbP| Length = 147 Score = 27.7 bits (60), Expect = 8.6 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -3 Query: 183 LAAMRAWLASRSQVRWATEDEG-LWCRSVW 97 L A+ WLA + V W EG LWC + + Sbjct: 4 LTAIGRWLAKQHVVTWCVHHEGELWCANAF 33 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,197,257 Number of Sequences: 219361 Number of extensions: 659534 Number of successful extensions: 1911 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1907 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)