| Clone Name | rbaet98f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CS021_MOUSE (Q9D279) Protein C19orf21 homolog | 32 | 0.58 | 2 | ERCC5_XENLA (P14629) DNA-repair protein complementing XP-G cells... | 28 | 4.9 |
|---|
>CS021_MOUSE (Q9D279) Protein C19orf21 homolog| Length = 648 Score = 31.6 bits (70), Expect = 0.58 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +1 Query: 55 AKPLLSRAWWRERPVRRTDNGRPRVHVQRD 144 ++PLLS+ E P RR D GRP ++VQRD Sbjct: 296 SRPLLSKMSLTETPPRR-DRGRPSLYVQRD 324
>ERCC5_XENLA (P14629) DNA-repair protein complementing XP-G cells homolog| (Xeroderma pigmentosum group G-complementing protein homolog) Length = 1196 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +2 Query: 47 PTLQSHYYQEPGGGRGQCGARTMAAPAYTSNGTS 148 PT S Q+PGGG +T+++ AY+S+G+S Sbjct: 1096 PTECSQEDQDPGGGFIGIELKTLSSKAYSSDGSS 1129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,984,667 Number of Sequences: 219361 Number of extensions: 446603 Number of successful extensions: 1523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1518 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)