| Clone Name | rbaet98f06 |
|---|---|
| Clone Library Name | barley_pub |
>BGLX_SALTY (Q56078) Periplasmic beta-glucosidase precursor (EC 3.2.1.21)| (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) (T-cell inhibitor) Length = 765 Score = 30.4 bits (67), Expect = 1.3 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 21/61 (34%) Frame = -1 Query: 258 GDYGFSGKLARTWFKSADQLP-----MNVG----------------DKHYDPLFPFGFGL 142 GDY SGKL ++ +S Q+P +N G D+ PL+PFG+GL Sbjct: 587 GDYNPSGKLPISFPRSVGQIPVYYSHLNTGRPYNPEKPNKYTSRYFDEANGPLYPFGYGL 646 Query: 141 T 139 + Sbjct: 647 S 647
>ACPD_VIBPA (Q87PP9) Putative acyl carrier protein phosphodiesterase (EC| 3.1.4.14) (ACP phosphodiesterase) Length = 194 Score = 28.5 bits (62), Expect = 4.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -1 Query: 258 GDYGFSGKLARTWFKSADQLPMNVGDKHYDPLFPFGFGLTT 136 GDY S KL + K+ DQ + V D +PL F + T Sbjct: 13 GDYSQSNKLVEDFIKNVDQDKLTVRDLAANPLPVLDFAVAT 53
>BGLS_AGRTU (P27034) Beta-glucosidase (EC 3.2.1.21) (Gentiobiase) (Cellobiase)| (Beta-D-glucoside glucohydrolase) Length = 818 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/21 (61%), Positives = 15/21 (71%), Gaps = 5/21 (23%) Frame = -1 Query: 189 VGDKHYD-----PLFPFGFGL 142 VG +H+D PLFPFGFGL Sbjct: 671 VGYRHHDTREIEPLFPFGFGL 691
>GCSP_YEAST (P49095) Glycine dehydrogenase [decarboxylating], mitochondrial| precursor (EC 1.4.4.2) (Glycine decarboxylase) (Glycine cleavage system P-protein) Length = 1034 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/29 (41%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = +3 Query: 6 RLHRSFIANKSTTKRNVCMYPIS-HSHSP 89 R+ RS++ +K RNVC+ P+S H +P Sbjct: 646 RVIRSYLESKGENHRNVCLIPVSAHGTNP 674
>BGLX_ECOLI (P33363) Periplasmic beta-glucosidase precursor (EC 3.2.1.21)| (Gentiobiase) (Cellobiase) (Beta-D-glucoside glucohydrolase) Length = 765 Score = 28.1 bits (61), Expect = 6.2 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 21/61 (34%) Frame = -1 Query: 258 GDYGFSGKLARTWFKSADQLP-----MNVG----------------DKHYDPLFPFGFGL 142 GDY SGKL ++ +S Q+P +N G D+ L+PFG+GL Sbjct: 587 GDYNPSGKLPMSFPRSVGQIPVYYSHLNTGRPYNADKPNKYTSRYFDEANGALYPFGYGL 646 Query: 141 T 139 + Sbjct: 647 S 647
>GHR_MOUSE (P16882) Growth hormone receptor precursor (GH receptor)| (Somatotropin receptor) [Contains: Growth hormone-binding protein (GH-binding protein) (GHBP) (Serum-binding protein)] Length = 650 Score = 27.7 bits (60), Expect = 8.1 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 43 QNAMYVCIPSLTVTAQPIETHPISPDS 123 Q +Y+ SLT TAQ ET I+PD+ Sbjct: 573 QEDIYITTESLTTTAQMSETADIAPDA 599
>RENT1_ARATH (Q9FJR0) Regulator of nonsense transcripts 1 homolog (EC 3.6.1.-)| (ATP-dependent helicase UPF1) Length = 1254 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 38 NHKTQCMYVSHLSQSQPNRSRHIPSHP 118 ++ TQ + +S QSQPN+S P HP Sbjct: 1225 HYNTQPLNLSGPQQSQPNQSSQNPKHP 1251 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,349,196 Number of Sequences: 219361 Number of extensions: 524712 Number of successful extensions: 1663 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1661 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)