| Clone Name | rbaet95e09 |
|---|---|
| Clone Library Name | barley_pub |
>MED15_YEAST (P19659) RNA polymerase II mediator complex subunit 15 (Galactose| metabolism protein 11) (Basal expression activator protein 1) (Autonomous replication regulatory protein 3) (Defective silencing suppressor protein 4) (Ty insertion suppressor Length = 1081 Score = 30.8 bits (68), Expect = 1.4 Identities = 14/49 (28%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = -3 Query: 402 HQELVEKVRIEAEPLHDLFQKHNDMSGLP----VNDDLDIPESVGLSTP 268 HQ+L+ K R++ + Q +N+ +GLP +N++++IP+ + P Sbjct: 223 HQQLLFKARLQQQQAQAQAQANNNNNGLPQNGNINNNINIPQQQQMQPP 271
>CSMD1_HUMAN (Q96PZ7) CUB and sushi domain-containing protein 1 precursor (CUB and| sushi multiple domains protein 1) Length = 3565 Score = 30.4 bits (67), Expect = 1.8 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 251 FTDDGWGVDSPTDSGMSRSSFTGRPDI 331 F +D WG+D SG+ R FT + DI Sbjct: 3429 FENDNWGLDGYVSSGLERGGFTFQGDI 3455
>SPSG_BACSU (P39627) Spore coat polysaccharide biosynthesis protein spsG| Length = 339 Score = 29.3 bits (64), Expect = 3.9 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = -3 Query: 414 SRACHQELVEKVRIEAEPLHDLFQKHNDMSGLPVNDDLDI 295 S + HQE V + RIE +P + + ++ NDM+GL D I Sbjct: 203 SASPHQEAVRR-RIEKKPQYKMIEQTNDMAGLMKQADAAI 241
>LIMK2_HUMAN (P53671) LIM domain kinase 2 (EC 2.7.11.1) (LIMK-2)| Length = 638 Score = 29.3 bits (64), Expect = 3.9 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 207 ASLCCALPSLNRPAFSRTMAGEWTAPLILGCQGHHLPAGL 326 A++CC L +RPAFS+ L LG G LPA L Sbjct: 580 AAICCRLEPESRPAFSKLEDSFEALSLYLGELGIPLPAEL 619
>CSMD1_MOUSE (Q923L3) CUB and sushi domain-containing protein 1 precursor (CUB and| sushi multiple domains protein 1) Length = 3564 Score = 28.9 bits (63), Expect = 5.2 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +2 Query: 251 FTDDGWGVDSPTDSGMSRSSFTGRPDI 331 F +D WG+D SG+ R F+ + DI Sbjct: 3428 FENDNWGLDGYVSSGLERGGFSFQGDI 3454
>CAR15_MOUSE (Q8K3Z0) Caspase recruitment domain-containing protein 15 (Nod2| protein) Length = 1020 Score = 28.5 bits (62), Expect = 6.7 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -2 Query: 298 HPRISGAVHSPAIVREKAGRFKLGKAQHKEAGFVSQAGCPSE*IAMLPIYIYRERA 131 HP H PAIVR + +E GF+SQ C LPI+ +RA Sbjct: 109 HPTRDLQSHRPAIVRRLYNHVEAMLELAREGGFLSQYECEE---IRLPIFTSSQRA 161
>ZN564_HUMAN (Q8TBZ8) Zinc finger protein 564| Length = 553 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = -1 Query: 377 GSKPSRCTTCSRSITICQAC-R*MMTLTSQNQWGCP 273 G KP +C C ++ + CQ+ R T T + + CP Sbjct: 137 GEKPYKCKQCGKAFSSCQSFRRHERTHTGEKPYACP 172
>SLT11_CANAL (Q5A5N5) Pre-mRNA-splicing factor SLT11| Length = 303 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 413 PVLVTRSWWRK*GSKPSRCTTCSRSITICQAC 318 P + R RK G+K C TC+R+ CQ+C Sbjct: 36 PYTIYRWGNRKQGNKTIICITCARARHCCQSC 67
>SINAL_DROME (Q8T3Y0) Probable ubiquitin ligase sina-like protein CG13030 (EC| 6.3.2.-) Length = 351 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -1 Query: 359 CTTCSRSITICQACR*MMT 303 C+TC +TIC CR MT Sbjct: 127 CSTCRSKLTICPVCRVFMT 145
>ZCHC8_XENLA (Q6DD45) Zinc finger CCHC domain-containing protein 8| Length = 743 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 402 HQELVEKVRIEAEPLHDLFQKHNDMSGLPVNDDLDIP 292 H+E + ++ E + L N SGLPV D LD P Sbjct: 44 HEETINRLSAENQELKRRLSLLNRPSGLPVEDKLDGP 80
>BHLH3_HUMAN (Q9C0J9) Class B basic helix-loop-helix protein 3 (bHLHB3)| (Differentially expressed in chondrocytes protein 2) (hDEC2) (Enhancer-of-split and hairy-related protein 1) (SHARP-1) Length = 482 Score = 28.1 bits (61), Expect = 8.8 Identities = 20/51 (39%), Positives = 22/51 (43%) Frame = -2 Query: 418 SFPCLSPGAGGESEDRSRAAARLVPEA*RYVRPAGK**P*HPRISGAVHSP 266 +FPCLS E AAA L+P V P G P HP G H P Sbjct: 411 AFPCLSSVLSPPPEKAGAAAATLLPHE---VAPLGAPHPQHPH--GRTHLP 456 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,186,194 Number of Sequences: 219361 Number of extensions: 1183574 Number of successful extensions: 3570 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3569 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)