| Clone Name | rbaet94d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein | 38 | 0.011 | 2 | CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor ... | 37 | 0.024 | 3 | 14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor | 34 | 0.16 | 4 | ITA2_DROME (P12080) Integrin alpha-PS2 precursor (Position-speci... | 29 | 3.8 | 5 | GALT3_CAEEL (P34678) Polypeptide N-acetylgalactosaminyltransfera... | 28 | 6.6 | 6 | NOLC_RHIFR (P26508) Protein nolC | 28 | 8.6 |
|---|
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 37.7 bits (86), Expect = 0.011 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = -3 Query: 412 GDASVKCCPLVQXXXXXXXXXXXXXXXXXKVLNLALYVPLAHQLLVNDCGCAVPPGYTC 236 G A CCPL+ K+LN+ + +P+A Q+L++DCG P + C Sbjct: 285 GSAKQTCCPLLGGLVDLDAAICLCTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKC 343
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 36.6 bits (83), Expect = 0.024 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -3 Query: 397 KCCPLVQXXXXXXXXXXXXXXXXXKVLNLALYVPLAHQLLVNDCGCAVPPGYTC 236 +CCPL++ VL + L VPL+ ++N+CG P +TC Sbjct: 74 QCCPLLEGLVDLDAALCLCTAIKANVLGIHLNVPLSLNFILNNCGRICPEDFTC 127
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 33.9 bits (76), Expect = 0.16 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = -3 Query: 403 SVKCCPLVQXXXXXXXXXXXXXXXXXKVLNLALYVPLAHQLLVNDCGCAVPPGYTC 236 ++ CC L++ +L L +P+A L++N+CG VP G+ C Sbjct: 81 TLPCCSLLEGLVNLEAAVCLCTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFEC 136
>ITA2_DROME (P12080) Integrin alpha-PS2 precursor (Position-specific antigen 2| alpha chain) (Protein inflated) Length = 1396 Score = 29.3 bits (64), Expect = 3.8 Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 7/74 (9%) Frame = +2 Query: 110 MNKPEASGFIDTTLISNSWHNKLC-------TALHACAGTWNGRTDGSGAGVSRRHGAAA 268 +N+PE G I ++ + +N L + L A WN + S G A+ Sbjct: 881 LNQPETGGKIQCDDVAFNEYNLLLDEKLVKKSYLQAQGAIWNSAQVSGQSSSSSSSGGAS 940 Query: 269 VVDEQLVGEGHVKG 310 V E+ GEG V+G Sbjct: 941 VHIEKARGEGFVRG 954
>GALT3_CAEEL (P34678) Polypeptide N-acetylgalactosaminyltransferase 3 (EC| 2.4.1.41) (Protein-UDP acetylgalactosaminyltransferase 3) (UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3) (pp-GaNTase 3) (GalNAc-T1) Length = 612 Score = 28.5 bits (62), Expect = 6.6 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 197 CAGTWNGRTDGSGAGVSRRHGAAAVVDEQLVGEGHVKGE 313 C T NG+ DG G+ HGA L G+G ++ + Sbjct: 496 CVDT-NGKKDGQAPGIQACHGAGGNQAWSLTGKGEIRSD 533
>NOLC_RHIFR (P26508) Protein nolC| Length = 392 Score = 28.1 bits (61), Expect = 8.6 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -2 Query: 407 RQRQVLP-PGAGHRRAHRXGVPLHRHQGQ 324 R Q +P PG GHR AH G RH+G+ Sbjct: 202 RSLQQMPWPGPGHRGAHAVGQYSDRHRGR 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,929,293 Number of Sequences: 219361 Number of extensions: 825058 Number of successful extensions: 2272 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2269 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2228238148 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)