| Clone Name | rbaet94c12 |
|---|---|
| Clone Library Name | barley_pub |
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 55.8 bits (133), Expect = 5e-08 Identities = 23/37 (62%), Positives = 30/37 (81%) Frame = -3 Query: 395 GRQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 G +RDE +WS IF++AG+SDY+I+ LG R IIEVYP Sbjct: 328 GMERDEQEWSKIFSEAGYSDYRIIPVLGVRSIIEVYP 364
>7OMT9_MEDSA (O22309) Isoflavone-7-O-methytransferase 9 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 9) (7 IOMT-9) Length = 352 Score = 44.7 bits (104), Expect = 1e-04 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -3 Query: 404 CTKGRQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 C G++R+E +W +F +AGF YKI G +IE+YP Sbjct: 313 CLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT8_MEDSA (O24529) Isoflavone-7-O-methytransferase 8 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 8) (7-IOMT-8) Length = 352 Score = 44.7 bits (104), Expect = 1e-04 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -3 Query: 404 CTKGRQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 C G++R+E +W +F +AGF YKI G +IE+YP Sbjct: 313 CLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>7OMT6_MEDSA (O22308) Isoflavone-7-O-methytransferase 6 (EC 2.1.1.150)| (Isoflavone-O-methytransferase 6) (7-IOMT-6) Length = 352 Score = 44.7 bits (104), Expect = 1e-04 Identities = 17/40 (42%), Positives = 25/40 (62%) Frame = -3 Query: 404 CTKGRQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 C G++R+E +W +F +AGF YKI G +IE+YP Sbjct: 313 CLNGKERNEEEWKKLFIEAGFQHYKISPLTGFLSLIEIYP 352
>CVMT1_OCIBA (Q93WU3) Chavicol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase CVOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase CVOMT1) Length = 356 Score = 39.7 bits (91), Expect = 0.004 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 392 RQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 ++R N+W + + AGF+ YK+ G R +IE YP Sbjct: 321 KERTMNEWEKLISAAGFTSYKLTPAFGVRSLIEAYP 356
>EOMT1_OCIBA (Q93WU2) Eugenol O-methyltransferase (EC 2.1.1.146) ((Iso)eugenol| O-methyltransferase EOMT1) (S-adenosysl-L-methionine:(Iso)eugenol O-methyltransferase EOMT1) Length = 357 Score = 36.2 bits (82), Expect = 0.043 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 392 RQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 ++R ++W + AGF YK+ G R +IE YP Sbjct: 322 KERTMSEWEKLIYDAGFKSYKLTPAFGVRSLIEAYP 357
>6OMT_COPJA (Q9LEL6) (RS)-norcoclaurine 6-O-methyltransferase (EC 2.1.1.128)| (S-adenosyl-L-methionine:norcoclaurine 6-O-methyltransferase) (6-OMT) Length = 347 Score = 35.4 bits (80), Expect = 0.073 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = -3 Query: 401 TKGRQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 T G++R E +W + AG+ +KI + + +IE YP Sbjct: 308 TGGKERTEEEWKKLIHDAGYKGHKITQITAVQSVIEAYP 346
>4OMT_COPJA (Q9LEL5) 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase| (EC 2.1.1.116) (S-adenosyl-L-methionine:3'-hydroxy-N-methylcoclaurine 4'-O-methyltransferase) (4'-OMT) Length = 350 Score = 32.3 bits (72), Expect = 0.62 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 407 VCTKGRQRDENDWSTIFTKAGFSDYKIVKKLGARGIIEVYP 285 V T G++R + W I AGFS KI + +IEV+P Sbjct: 310 VNTGGKERTKEVWEKIVKSAGFSGCKIRHIAAIQSVIEVFP 350
>RR3_EMIHU (Q4G359) Chloroplast 30S ribosomal protein S3| Length = 216 Score = 30.0 bits (66), Expect = 3.1 Identities = 13/28 (46%), Positives = 19/28 (67%) Frame = -3 Query: 398 KGRQRDENDWSTIFTKAGFSDYKIVKKL 315 K R+ ENDW T++ KAG S +I +K+ Sbjct: 38 KIRKFFENDWGTLYNKAGVSKVEIKRKV 65
>YNV7_YEAST (P40152) Putative metallophosphoesterase YNL217W precursor (EC| 3.1.-.-) Length = 326 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 89 HFIETKDTYIDPDMAKWAYDLTTYSPLDFSLQTWSLP 199 H I Y++PD +KW +PL FS +T +P Sbjct: 127 HEILVMMAYLNPDFSKWVRRPKLMTPLTFSTETNFIP 163 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,150,018 Number of Sequences: 219361 Number of extensions: 1120088 Number of successful extensions: 2687 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2567 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2679 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)