ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet93c06 |
|---|---|
| Clone Library Name | barley_pub |
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 48.5 bits (114), Expect = 4e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESGKA 238 QVQCVSFIAFRPPGCEESGKA Sbjct: 154 QVQCVSFIAFRPPGCEESGKA 174
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 48.5 bits (114), Expect = 4e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESGKA 238 QVQCVSFIAFRPPGCEESGKA Sbjct: 155 QVQCVSFIAFRPPGCEESGKA 175
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 47.4 bits (111), Expect = 9e-06 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESGKA 238 QVQCVSFIAF+PPGCEESGKA Sbjct: 93 QVQCVSFIAFKPPGCEESGKA 113
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 46.2 bits (108), Expect = 2e-05 Identities = 19/21 (90%), Positives = 21/21 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESGKA 238 QVQCVSFIAF+PPGC+ESGKA Sbjct: 154 QVQCVSFIAFKPPGCQESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 40.4 bits (93), Expect = 0.001 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESGKA 238 QVQ VSFIA +PPGCEESGKA Sbjct: 155 QVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESG 244 QVQ +SFIA++PPGCEESG Sbjct: 155 QVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 38.5 bits (88), Expect = 0.004 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESG 244 QVQ +SFIA++PPGCEESG Sbjct: 155 QVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 32.7 bits (73), Expect = 0.24 Identities = 13/14 (92%), Positives = 14/14 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQCVSFIAF+PPG Sbjct: 166 QVQCVSFIAFKPPG 179
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 31.2 bits (69), Expect = 0.70 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++PPG Sbjct: 164 QVQCISFIAYKPPG 177
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 31.2 bits (69), Expect = 0.70 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++PPG Sbjct: 166 QVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 31.2 bits (69), Expect = 0.70 Identities = 11/14 (78%), Positives = 14/14 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++PPG Sbjct: 166 QVQCISFIAYKPPG 179
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEESG 244 QVQ +SFIA+ PGCEESG Sbjct: 153 QVQLISFIAYN-PGCEESG 170
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 30.4 bits (67), Expect = 1.2 Identities = 10/14 (71%), Positives = 14/14 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SF+A++PPG Sbjct: 168 QVQCISFLAYKPPG 181
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCE 253 Q QCVSFIA++PPG + Sbjct: 155 QTQCVSFIAYKPPGSD 170
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEES 247 QVQC+SFIA++PP E+ Sbjct: 164 QVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCEES 247 QVQC+SFIA++PP E+ Sbjct: 164 QVQCISFIAYKPPSFTEA 181
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -2 Query: 300 QVQCVSFIAFRPPGCE 253 QVQC+SF+A++P G E Sbjct: 168 QVQCISFLAYKPKGAE 183
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 65 QVQCISFIAYKPP 77
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 168 QVQCISFIAYKPP 180
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 28.9 bits (63), Expect = 3.5 Identities = 10/13 (76%), Positives = 13/13 (100%) Frame = -2 Query: 300 QVQCVSFIAFRPP 262 QVQC+SFIA++PP Sbjct: 164 QVQCISFIAYKPP 176
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQCVSFIA++P G Sbjct: 168 QVQCVSFIAYKPAG 181
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQCVSFIA++P G Sbjct: 166 QVQCVSFIAYKPAG 179
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 169 QVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 169 QVQCISFIAYKPAG 182
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPTG 179
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 168 QVQCISFIAYKPKG 181
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 167 QVQCISFIAYKPEG 180
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 167 QVQCISFIAYKPEG 180
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 167 QVQCISFIAYKPEG 180
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 166 QVQCISFIAYKPEG 179
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 167 QVQCISFIAYKPEG 180
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFIA++P G Sbjct: 167 QVQCISFIAYKPEG 180
>PI3K2_SOYBN (P42348) Phosphatidylinositol 3-kinase, nodule isoform (EC| 2.7.1.137) (PI3-kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-1) Length = 812 Score = 28.1 bits (61), Expect = 5.9 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 149 HNFLLYDLCMYEHRLCGIYAYVNSSTAYTYPTPVS 45 H +L+ D C +EHR+ + S + +P+P++ Sbjct: 206 HMYLVVDFCSFEHRV----VFQESGANFLFPSPIA 236
>PI3K1_SOYBN (P42347) Phosphatidylinositol 3-kinase, root isoform (EC 2.7.1.137)| (PI3-kinase) (PtdIns-3-kinase) (PI3K) (SPI3K-5) Length = 814 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 149 HNFLLYDLCMYEHRLCGIYAYVNSSTAYTYPTPVS 45 H +L+ D C +EHR+ + S + +P+P++ Sbjct: 208 HLYLVVDFCSFEHRV----VFQESGANFLFPSPIA 238
>MUC1_MOUSE (Q02496) Mucin-1 precursor (Polymorphic epithelial mucin) (PEMT)| (Episialin) Length = 630 Score = 27.7 bits (60), Expect = 7.7 Identities = 32/103 (31%), Positives = 41/103 (39%), Gaps = 9/103 (8%) Frame = -3 Query: 287 SASSPSGHRVARSPARHKLRGETMAYVV*RSSV-NFTFVHDSAFRLEHN--------FLL 135 SASSP H SPA LR T + V +S+ N D A +HN L Sbjct: 227 SASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVTTTSSAL 286 Query: 134 YDLCMYEHRLCGIYAYVNSSTAYTYPTPVSYLSLPNNKEAINS 6 +H G NSS + TPV Y S+P + + S Sbjct: 287 GSATSPDH--SGTSTTTNSSESVLATTPV-YSSMPFSTTKVTS 326
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 27.7 bits (60), Expect = 7.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 300 QVQCVSFIAFRPPG 259 QVQC+SFI +PPG Sbjct: 166 QVQCISFIVAKPPG 179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,415,707 Number of Sequences: 219361 Number of extensions: 690079 Number of successful extensions: 1489 Number of sequences better than 10.0: 51 Number of HSP's better than 10.0 without gapping: 1467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1488 length of database: 80,573,946 effective HSP length: 75 effective length of database: 64,121,871 effective search space used: 1538924904 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
