| Clone Name | rbaet93c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-as... | 28 | 4.4 | 2 | ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT) | 28 | 4.4 | 3 | PA2A_CROSS (P18998) Mojave toxin acidic chain precursor (Mtx-a) ... | 27 | 9.7 | 4 | ABC3C_HUMAN (Q9NRW3) Probable DNA dC->dU-editing enzyme APOBEC-3... | 27 | 9.7 |
|---|
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 28.5 bits (62), Expect = 4.4 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = -2 Query: 316 CQEA--GSSSCH*GLSIRLCDQSNICLHICCGLLC 218 CQ A SS C + +C +SN C +CC +C Sbjct: 104 CQPACCTSSPCQQACCVPVCCKSNCCKPVCCVSIC 138
>ZRP4_MAIZE (P47917) O-methyltransferase ZRP4 (EC 2.1.1.-) (OMT)| Length = 364 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = -3 Query: 330 SGYKIVKKLGARAVIEVYP 274 S Y+I+ LG R++IEVYP Sbjct: 346 SDYRIIPVLGVRSIIEVYP 364
>PA2A_CROSS (P18998) Mojave toxin acidic chain precursor (Mtx-a) [Contains:| Mojave toxin acidic chain A; Mojave toxin acidic chain B; Mojave toxin acidic chain C] Length = 138 Score = 27.3 bits (59), Expect = 9.7 Identities = 20/74 (27%), Positives = 26/74 (35%) Frame = -3 Query: 243 CIYVVDCCVCSL*GRINKGVPCIFQSEVLQIIN*QGCDVLSSYDPCANFLLEKDSMQLDC 64 C + DCC L G C ++V G V DPC + E D C Sbjct: 59 CCFEHDCCYAKLTG-------CDPTTDVYTYRQEDGEIVCGGDDPCGTQICECDKAAAIC 111 Query: 63 FSYSMYYVQYPTIK 22 F SM Y ++ Sbjct: 112 FRDSMNTYDYKYLR 125
>ABC3C_HUMAN (Q9NRW3) Probable DNA dC->dU-editing enzyme APOBEC-3C (EC 3.5.4.-)| (APOBEC1-like) (Phorbolin I protein) Length = 190 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 7/38 (18%) Frame = -3 Query: 123 SSYDPC-------ANFLLEKDSMQLDCFSYSMYYVQYP 31 +S+ PC A FL ++ L F+ +YY QYP Sbjct: 92 TSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYP 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,065,331 Number of Sequences: 219361 Number of extensions: 791122 Number of successful extensions: 1441 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1440 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)