| Clone Name | rbaet92f06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ERMA_CORDI (P16898) rRNA adenine N-6-methyltransferase (EC 2.1.1... | 30 | 2.9 | 2 | ILPR_BRALA (O02466) Insulin-like peptide receptor precursor (EC ... | 29 | 3.7 | 3 | ZN444_HUMAN (Q8N0Y2) Zinc finger protein 444 (Endothelial zinc f... | 29 | 4.9 | 4 | ACK2_BOVIN (O02742) Activated CDC42 kinase 2 (EC 2.7.10.2) (ACK-2) | 29 | 4.9 |
|---|
>ERMA_CORDI (P16898) rRNA adenine N-6-methyltransferase (EC 2.1.1.48)| (Macrolide-lincosamide-streptogramin B resistance protein) (Erythromycin resistance protein) Length = 253 Score = 29.6 bits (65), Expect = 2.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -1 Query: 332 RRQHPLHHPQLHGRAARRSWTGPAPRRPSCT 240 RRQ HH Q H R + P P P CT Sbjct: 214 RRQGCFHHVQKHNHGCAREESTPRPYLPDCT 244
>ILPR_BRALA (O02466) Insulin-like peptide receptor precursor (EC 2.7.10.1) (ILP| receptor) [Contains: Insulin-like peptide receptor alpha chain; Insulin-like peptide receptor beta chain] Length = 1363 Score = 29.3 bits (64), Expect = 3.7 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = +2 Query: 47 LHKNICS--ENNCNLQQSGDEAPTE*R---TNHQSNVTMPPAGRQLPPTPS 184 LH N+ EN + E P R +N NVT+P R +PPTP+ Sbjct: 701 LHNNVYHKRENETRAGRRRRELPVTARPFYSNQTVNVTLPSTNRTVPPTPT 751
>ZN444_HUMAN (Q8N0Y2) Zinc finger protein 444 (Endothelial zinc finger protein| 2) (EZF-2) (Zinc finger and SCAN domain-containing protein 17) Length = 327 Score = 28.9 bits (63), Expect = 4.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 332 RRQHPLHHPQLHGRAARRSWTGPAP 258 RR+H L H ++HGRAA + AP Sbjct: 289 RREHVLRHQRIHGRAAASAQGAVAP 313
>ACK2_BOVIN (O02742) Activated CDC42 kinase 2 (EC 2.7.10.2) (ACK-2)| Length = 747 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 5/48 (10%) Frame = +2 Query: 59 ICSENNCNLQQSGDEAPTE*RTNH----QSNVTMPPAGRQ-LPPTPSW 187 +CS N+ + P++ TN+ + +PPAG Q +PPTP W Sbjct: 661 VCSINSTLVGAGVSAEPSQGETNYAFVPEPARLLPPAGGQPVPPTPEW 708 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,900,377 Number of Sequences: 219361 Number of extensions: 636886 Number of successful extensions: 1617 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1596 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1617 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)