| Clone Name | rbaet92f03 |
|---|---|
| Clone Library Name | barley_pub |
>COG1_MOUSE (Q9Z160) Conserved oligomeric Golgi complex component 1 (Low| density lipoprotein receptor defect B-complementing protein) Length = 980 Score = 28.9 bits (63), Expect = 3.1 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -2 Query: 230 SLSTIQRNHSQGNGLGGISGERRPC 156 +L T+ R H G G+G + GE + C Sbjct: 293 TLETVTRQHPTGKGIGALQGEMKLC 317
>HBA1_PLEWA (P06639) Hemoglobin alpha-1 subunit (Hemoglobin alpha-1 chain)| (Alpha-1-globin) (Hemoglobin alpha-major chain) Length = 141 Score = 27.7 bits (60), Expect = 6.9 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 240 IPTVPVYYPAKPQPRERAWRNQRGKKTLLSLT 145 +PT +Y+PAK ++ + GKK + +LT Sbjct: 36 MPTTRIYFPAKDLSERSSYLHSHGKKVVGALT 67
>NALP2_HUMAN (Q9NX02) NACHT-, LRR- and PYD-containing protein 2 (PYRIN domain-| and NACHT domain-containing protein 1) (PYRIN-containing APAF1-like protein 2) (Nucleotide-binding site protein 1) Length = 1062 Score = 27.7 bits (60), Expect = 6.9 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = -1 Query: 162 TLLSLTLVR-LCEMTQSTVG*CKCSTYRSSSMHIAFFHLCLLLRGIDPCTYL 10 + LS +LVR LCE S + +++ S A +LCL LRG TYL Sbjct: 709 SFLSASLVRILCEQIASDTCHLQRVVFKNISPADAHRNLCLALRGHKTVTYL 760
>HETR_ANAVT (Q9F5Y3) Heterocyst differentiation control protein (EC 3.4.21.-)| Length = 299 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 294 GSQMPRHLISDAHEWINEIPTVP 226 GSQ PR+LI + W+ + P +P Sbjct: 96 GSQEPRYLIQFPYVWMEQYPWIP 118
>HETR_ANASP (P27709) Heterocyst differentiation control protein (EC 3.4.21.-)| Length = 298 Score = 27.3 bits (59), Expect = 9.0 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 294 GSQMPRHLISDAHEWINEIPTVP 226 GSQ PR+LI + W+ + P +P Sbjct: 95 GSQEPRYLIQFPYVWMEQYPWIP 117
>SYFB_CHLPN (Q9Z7W0) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 792 Score = 27.3 bits (59), Expect = 9.0 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -2 Query: 305 DSLKVAKCPVI*LVTRMNGLT-RFPLSLSTIQRNHSQGNGLGGISGERRP 159 DSL+V K +T +NG T P + ++ +HS GLGG+ G + P Sbjct: 277 DSLRVEKLSTPESLTLLNGETVLLPSGVPVVRDDHSL-LGLGGVMGAKAP 325
>GPR88_RAT (Q9ESP4) Probable G-protein coupled receptor 88 (Striatum-specific| G-protein coupled receptor) Length = 384 Score = 27.3 bits (59), Expect = 9.0 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 7/76 (9%) Frame = -1 Query: 219 YPAKPQPRERAWRNQRGKKTLLSLTLVRLCEM----TQSTVG*CKCSTYRSS---SMHIA 61 +PA+PQP A + +R ++ L L+++ LC + TQ V S + + A Sbjct: 261 HPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAA 320 Query: 60 FFHLCLLLRGIDPCTY 13 + LC L ++P Y Sbjct: 321 SWLLCCALSALNPLLY 336
>GPR88_MOUSE (Q9EPB7) Probable G-protein coupled receptor 88 (Striatum-specific| G-protein coupled receptor) Length = 384 Score = 27.3 bits (59), Expect = 9.0 Identities = 21/76 (27%), Positives = 36/76 (47%), Gaps = 7/76 (9%) Frame = -1 Query: 219 YPAKPQPRERAWRNQRGKKTLLSLTLVRLCEM----TQSTVG*CKCSTYRSS---SMHIA 61 +PA+PQP A + +R ++ L L+++ LC + TQ V S + + A Sbjct: 261 HPAQPQPLPAALQPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAA 320 Query: 60 FFHLCLLLRGIDPCTY 13 + LC L ++P Y Sbjct: 321 SWLLCCALSALNPLLY 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,240,744 Number of Sequences: 219361 Number of extensions: 861021 Number of successful extensions: 1932 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1909 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1932 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)