ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet92a01 |
|---|---|
| Clone Library Name | barley_pub |
>EXG_CANOL (Q8NKF9) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 425 Score = 51.6 bits (122), Expect = 7e-07 Identities = 27/92 (29%), Positives = 51/92 (55%), Gaps = 5/92 (5%) Frame = -2 Query: 392 LLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSS-EAY--VIMSNRLSSPDP--TELL 228 ++ +ELLNEPL P ++ L+ +Y+DGY+ +R + E+Y +I+ + D + Sbjct: 206 VIGIELLNEPLGPVLDMDGLRQFYQDGYSEIRNNDGVESYNAIIIHDAFQQTDHYWDNFM 265 Query: 227 EFAGGLPKAVVDVHYYVLFNSMFDTFTVQQNI 132 + +GG VVD H+Y +F+ ++ +I Sbjct: 266 QVSGGYWNVVVDHHHYQVFDQAALELLIEDHI 297
>EXG_CANAL (P29717) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 438 Score = 49.3 bits (116), Expect = 4e-06 Identities = 28/79 (35%), Positives = 44/79 (55%), Gaps = 1/79 (1%) Frame = -2 Query: 401 SPSLLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDP-TELLE 225 S ++ +ELLNEPL P +++ LK ++ DGYN++R+ S VI+ + L Sbjct: 219 SDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLT 278 Query: 224 FAGGLPKAVVDVHYYVLFN 168 A G VVD H+Y +F+ Sbjct: 279 VAEGQWNVVVDHHHYQVFS 297
>EXG_SACKL (Q875R9) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 439 Score = 43.9 bits (102), Expect = 2e-04 Identities = 27/86 (31%), Positives = 46/86 (53%), Gaps = 2/86 (2%) Frame = -2 Query: 416 SRYAASPSLLAVELLNEPLAPRASLESLKTYYRDGYNAVRKH-SSEAYVIMSNRLSSPDP 240 SR +++ +EL+NEPL P ++ LK YY+ GY+ +R S+ V++ + + + Sbjct: 211 SREEYLDTVIGIELINEPLGPVLDMDKLKEYYQFGYDYLRNELGSDQIVVIHDAFEAYNY 270 Query: 239 TE-LLEFAGGLPKAVVDVHYYVLFNS 165 + L G VVD H+Y F+S Sbjct: 271 WDSTLTVEDGSWGVVVDHHHYQCFSS 296
>EXG_BLUGR (Q96V64) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 426 Score = 43.5 bits (101), Expect = 2e-04 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = -2 Query: 419 ASRYAASPSLL-AVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPD 243 A RYA ++ A+ELLNEP L +K +Y DG+ VR A I L Sbjct: 190 AERYAPQTDVVTAIELLNEPANWGNDLSQIKKFYYDGWGNVRTQGQTAVTIHDAFLDPRS 249 Query: 242 PTELLEFAGGLPKAVVDVHYYVLFN 168 + G+ ++D H Y +F+ Sbjct: 250 WNGFMNSEAGVNNVILDTHIYQVFS 274
>EXG_DEBOC (Q12700) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 425 Score = 42.4 bits (98), Expect = 5e-04 Identities = 23/76 (30%), Positives = 37/76 (48%) Frame = -2 Query: 392 LLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDPTELLEFAGG 213 ++ +ELLNEPL P L LK +++ GY +R S VI+ + + Sbjct: 211 VIGIELLNEPLGPSLDLNYLKEFFQQGYQNLRNSGSVQAVIIQDAFQPMGYWDNFLTLDQ 270 Query: 212 LPKAVVDVHYYVLFNS 165 VVD H+Y +F++ Sbjct: 271 YWNVVVDHHHYQVFSA 286
>EXG_ASPOR (Q7Z9L3) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 405 Score = 42.0 bits (97), Expect = 6e-04 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 1/100 (1%) Frame = -2 Query: 419 ASRYAASPSLLAVELLNEPLAP-RASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPD 243 A RY S ++ A+E +NEP P L+ YY Y V K+++ V+ + + Sbjct: 182 AERYLGSDTVAAIEAINEPNIPGGVDQGKLQEYYGSVYGIVNKYNAGTSVVYGDGFLPVE 241 Query: 242 PTELLEFAGGLPKAVVDVHYYVLFNSMFDTFTVQQNIDFI 123 + G K V+D H+Y +F++ + +ID + Sbjct: 242 SWNGFKTEGS--KVVMDTHHYHMFDNGLIAMDIDSHIDAV 279
>EXG_YARLI (Q12725) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 421 Score = 41.6 bits (96), Expect = 8e-04 Identities = 23/88 (26%), Positives = 45/88 (51%), Gaps = 4/88 (4%) Frame = -2 Query: 419 ASRYAA---SPSLLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSS 249 A +Y A + ++ +EL+NEPL P +E ++ Y+++G+ VR S+ V++ + Sbjct: 193 AGKYGAPEYNDIVVGIELVNEPLGPAIGMEVIEKYFQEGFWTVRHAGSDTAVVIHDAFQE 252 Query: 248 PDP-TELLEFAGGLPKAVVDVHYYVLFN 168 + + G V+D H Y +F+ Sbjct: 253 KNYFNNFMTTEQGFWNVVLDHHQYQVFS 280
>EXG_PICAN (Q12626) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 435 Score = 40.8 bits (94), Expect = 0.001 Identities = 27/93 (29%), Positives = 44/93 (47%), Gaps = 2/93 (2%) Frame = -2 Query: 401 SPSLLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDPTELL-- 228 S ++ +ELLNEPL + L +Y GY VR + + +I L +L Sbjct: 211 SDVIIGIELLNEPLGSYLDFDQLVDFYNKGYQLVRNNGNAPVIIHDAYLPDHTFDNVLNT 270 Query: 227 EFAGGLPKAVVDVHYYVLFNSMFDTFTVQQNID 129 E + + +VD H+Y +FD ++ Q+ID Sbjct: 271 EQDPNVWEVIVDHHHY----QVFDEGSLSQSID 299
>EXG2_HANAN (O93983) Glucan 1,3-beta-glucosidase 2 precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase 2) Length = 427 Score = 37.4 bits (85), Expect = 0.015 Identities = 20/75 (26%), Positives = 36/75 (48%) Frame = -2 Query: 392 LLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDPTELLEFAGG 213 ++ +ELLNEPL + L +++ GY+ +R S VI+ + + D Sbjct: 209 VIGIELLNEPLGSVLDMGKLNDFWQQGYHNLRNTGSSQNVIIHDAFQTWDSFNDKFHTPD 268 Query: 212 LPKAVVDVHYYVLFN 168 V+D H+Y +F+ Sbjct: 269 YWNVVIDHHHYQVFS 283
>EXG1_SCHPO (Q9URU6) Glucan 1,3-beta-glucosidase 1 precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 407 Score = 37.0 bits (84), Expect = 0.019 Identities = 25/84 (29%), Positives = 39/84 (46%) Frame = -2 Query: 416 SRYAASPSLLAVELLNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDPT 237 S+YA+ ++ +E +NEPL ++ LK Y D YN V SS I+ + Sbjct: 199 SQYASV--VIGIETVNEPLGYGLDMDQLKQYDLDAYNIVNPLSSSVATIIHDAYVDLSIW 256 Query: 236 ELLEFAGGLPKAVVDVHYYVLFNS 165 + + V+DVH Y L+ S Sbjct: 257 DYGVVSPSSYNLVMDVHRYQLYES 280
>EXG1_YEAST (P23776) Glucan 1,3-beta-glucosidase I/II precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase I/II) (Soluble cell wall protein 6) Length = 448 Score = 31.6 bits (70), Expect = 0.80 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = -2 Query: 395 SLLAVELLNEPLAPRASLESLKT-YYRDGYNAVRKHSSEAYVIMSNRLSSPDP--TELLE 225 +++ +EL+NEPL P ++ +K Y Y +R + VI+ + P + + Sbjct: 223 TVIGIELINEPLGPVLDMDKMKNDYLAPAYEYLRNNIKSDQVIIIHDAFQPYNYWDDFMT 282 Query: 224 FAGGLPKAVVDVHYYVLFNS 165 G +D H+Y +F S Sbjct: 283 ENDGYWGVTIDHHHYQVFAS 302
>SPR1_SACBA (Q876J2) Sporulation-specific glucan 1,3-beta-glucosidase precursor| (EC 3.2.1.58) (Exo-1,3-beta-glucanase) Length = 445 Score = 30.8 bits (68), Expect = 1.4 Identities = 22/81 (27%), Positives = 43/81 (53%), Gaps = 5/81 (6%) Frame = -2 Query: 395 SLLAVELLNEPLAPRASLESLKT-YYRDGYNAVR-KHSSEAYVIMSNRLSSPDPTELLEF 222 +++ +ELLNEPL P +E LK + + Y+ +R K S+ ++M + + + F Sbjct: 224 TVIGIELLNEPLGPVFDMERLKNLFLKPAYDYLRNKIMSKQIIVMHDAFQPYNYWD--NF 281 Query: 221 AGGLPK---AVVDVHYYVLFN 168 G + ++D H+Y +F+ Sbjct: 282 LNGDKEEYGVILDHHHYQVFS 302
>EXG_SACBA (Q876J3) Glucan 1,3-beta-glucosidase precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 448 Score = 30.4 bits (67), Expect = 1.8 Identities = 20/80 (25%), Positives = 38/80 (47%), Gaps = 3/80 (3%) Frame = -2 Query: 395 SLLAVELLNEPLAPRASLESLKT-YYRDGYNAVRKH-SSEAYVIMSNRLSSPDP-TELLE 225 +++ +EL+NEPL P ++ +K Y Y +R S +IM + + + + Sbjct: 223 TVIGIELINEPLGPVLDMDKMKNDYLLPAYEYLRNTIESNQIIIMHDAFQQFNYWDDFMT 282 Query: 224 FAGGLPKAVVDVHYYVLFNS 165 G +D H+Y +F+S Sbjct: 283 ETDGYWGVTIDHHHYQVFDS 302
>EXG2_SCHPO (Q10444) Glucan 1,3-beta-glucosidase 2 precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase) Length = 570 Score = 30.4 bits (67), Expect = 1.8 Identities = 18/97 (18%), Positives = 39/97 (40%) Frame = -2 Query: 374 LNEPLAPRASLESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDPTELLEFAGGLPKAVV 195 LNEP + +++ Y +R+ + + +S+ P E P ++ Sbjct: 336 LNEPNFFVLDEHKITDWHKQAYAVIRQSNFTGLISLSDGFRGPGNWEDHFDPFHFPNILI 395 Query: 194 DVHYYVLFNSMFDTFTVQQNIDFIKTNYSSALSTVTK 84 DVH Y++FN + ++ I +++ + K Sbjct: 396 DVHRYIIFNDFLIGLRPKDKLNVICKSWNEEMKLKAK 432
>SPR1_YEAST (P32603) Sporulation-specific glucan 1,3-beta-glucosidase precursor| (EC 3.2.1.58) (Exo-1,3-beta-glucanase) Length = 445 Score = 30.0 bits (66), Expect = 2.3 Identities = 22/91 (24%), Positives = 42/91 (46%), Gaps = 3/91 (3%) Frame = -2 Query: 395 SLLAVELLNEPLAPRASLESLKT-YYRDGYNAVRKHSSEAYVIMSNRLSSPDP--TELLE 225 +++ +ELLNEPL P +E LK + Y+ +R + +I+ + P L Sbjct: 224 TVIGIELLNEPLGPVIDMERLKNLLLKPAYDYLRNKINSNQIIVIHDAFQPYHYWDGFLN 283 Query: 224 FAGGLPKAVVDVHYYVLFNSMFDTFTVQQNI 132 ++D H+Y +F+ + T + + I Sbjct: 284 DEKNEYGVIIDHHHYQVFSQVELTRKMNERI 314
>FLHA_ECOLI (P76298) Flagellar biosynthesis protein flhA| Length = 692 Score = 30.0 bits (66), Expect = 2.3 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 111 IVGLDEINVLLHGKSIKHAVEQHVVVHVNDGL 206 IVG + VL HG S+ HA E + ++ + DGL Sbjct: 220 IVGGLLVGVLQHGMSMGHAAESYTLLTIGDGL 251
>TTLL4_MOUSE (Q80UG8) Tubulin--tyrosine ligase-like protein 4| Length = 1193 Score = 29.3 bits (64), Expect = 3.9 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +3 Query: 3 EQKNHAPKPKGAKILVTLTYKGERTVLLCDSA 98 EQK H K KG +L YKG T ++ DSA Sbjct: 1051 EQKYHGNKLKGVDLLRNWCYKGFHTGIVSDSA 1082
>HSP71_LYCES (P24629) Heat shock cognate 70 kDa protein 1| Length = 650 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +3 Query: 33 GAKILVTLTYKGERTVLLCDSAESA*IVGLDEINVLLHGKSIKHAV 170 G K ++ +TYKGE + S + + EI G ++K+AV Sbjct: 102 GDKPMIVVTYKGEEKEFAAEEISSMVLTKMKEIAEAFLGSTVKNAV 147
>CLCN1_CANFA (Q9MZT1) Chloride channel protein, skeletal muscle (Chloride| channel protein 1) (ClC-1) Length = 976 Score = 28.5 bits (62), Expect = 6.7 Identities = 17/53 (32%), Positives = 24/53 (45%) Frame = -3 Query: 355 PEHPWRA*KHTTAMGTTPSGSTRQRPT*SCPTGYRPQTRRSSLSSPVGYPRPS 197 P HP + ++ P S +Q+P P RP RS L +G PRP+ Sbjct: 725 PPHPLPSAPLSSEESNGPLPSHKQQPEAPEPADQRPSVFRSLLRCLLGRPRPT 777
>HSP7C_PETHY (P09189) Heat shock cognate 70 kDa protein| Length = 651 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 33 GAKILVTLTYKGERTVLLCDSAESA*IVGLDEINVLLHGKSIKHAV 170 G K ++ +TYKGE + S + + EI G +IK+AV Sbjct: 102 GDKPMIVVTYKGEEKQFAAEEISSMVLTKMKEIAEAYLGTTIKNAV 147
>Y398_MYCPN (P75385) Hypothetical protein MG279 homolog (F11_orf218)| Length = 218 Score = 28.1 bits (61), Expect = 8.8 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -2 Query: 341 ESLKTYYRDGYNAVRKHSSEAYVIMSNRLSSPDPTELLEFAGGLPKAV 198 E + YY++GYN V++++ E + S LSS EL++ G + ++ Sbjct: 36 EPINNYYKEGYNKVKQYNEEIKKV-SKSLSS---NELVKTLGDVESSI 79
>TRA1_CAEBR (Q17308) Sex-determining transformer protein 1| Length = 1165 Score = 28.1 bits (61), Expect = 8.8 Identities = 25/94 (26%), Positives = 37/94 (39%), Gaps = 16/94 (17%) Frame = +1 Query: 148 VKVSNMLLNNXXXXXXXXALGNPPANSRSSVG------SGDDNRLDMIT*ASDECFLTAL 309 VKV+ ++N L +PP + R+ +N L IT D+C L + Sbjct: 1011 VKVARTVINGKVVEYTESQLFSPPVSRRTIYSMLKQFPEHQENLLKFITLHVDKCELENV 1070 Query: 310 YPSR*YV----------FRLSRDALGASGSFNSS 381 PSR Y+ R+ R AL A G + Sbjct: 1071 IPSREYMSDMESSFFAHHRIVRAALRARGEITEA 1104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,642,555 Number of Sequences: 219361 Number of extensions: 1221909 Number of successful extensions: 3362 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 3288 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3361 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
