| Clone Name | rbaet91c11 |
|---|---|
| Clone Library Name | barley_pub |
>INVO_HUMAN (P07476) Involucrin| Length = 585 Score = 30.0 bits (66), Expect = 1.4 Identities = 24/75 (32%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +3 Query: 36 KNREHGLIHLDLQ-----LKEDIRVQPPFLASQKRQPKTHRPIHGWIQQLTMQQLSITHT 200 + +E L HLD Q L E Q L Q+ QPK G ++QL Q+ + H Sbjct: 287 EQQEGQLKHLDQQEKQPELPEQQMGQLKHLEQQEGQPKHLEQQEGQLEQLEEQEGQLKHL 346 Query: 201 QQQFIHAQIRHVIKQ 245 +QQ Q+ H+ Q Sbjct: 347 EQQ--EGQLEHLEHQ 359
>LVA_DROME (Q8MSS1) Protein lava lamp| Length = 2779 Score = 29.6 bits (65), Expect = 1.8 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 72 QLKEDIRVQPPFLASQKRQ-PKTHRPIHGWIQQLTMQQ-LSITHTQQQFIHAQIRHVIKQ 245 QL+E +RV +A Q R+ + + QQ+ Q L H ++QF + ++R +K+ Sbjct: 1026 QLREALRVSKSLVAQQVRELTSSQETVDALNQQIQEYQGLEHAHKEEQFKNRELREKLKK 1085 Query: 246 Y 248 Y Sbjct: 1086 Y 1086
>PEX1_HUMAN (O43933) Peroxisome biogenesis factor 1 (Peroxin-1) (Peroxisome| biogenesis disorder protein 1) Length = 1283 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/66 (22%), Positives = 31/66 (46%), Gaps = 11/66 (16%) Frame = +3 Query: 87 IRVQPPFLASQKRQPKTHRP-----------IHGWIQQLTMQQLSITHTQQQFIHAQIRH 233 + V P S K QP+ + P + W+QQ T L + ++++FI + + Sbjct: 435 VEVTPKIPRSLKLQPRENLPKDISEEDIKTVFYSWLQQSTTTMLPLVISEEEFIKLETKD 494 Query: 234 VIKQYT 251 +K+++ Sbjct: 495 GLKEFS 500
>SWC4_KLULA (Q6CSS3) SWR1-complex protein 4| Length = 497 Score = 28.1 bits (61), Expect = 5.2 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +3 Query: 114 SQKRQPKTHRPIHGWI---QQLTMQQLSITHTQQQFIHAQI 227 ++KR+P ++ P + W+ QQ Q+ I H QQQF QI Sbjct: 289 NRKRKPDSNTPENPWMKQQQQFAQQRQQIQH-QQQFKQGQI 328
>ASNO_BACSU (O05272) Asparagine synthetase [glutamine-hydrolyzing] 3 (EC| 6.3.5.4) Length = 614 Score = 28.1 bits (61), Expect = 5.2 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 9/63 (14%) Frame = +3 Query: 39 NREHGLIHLDLQ--LKEDI--RVQPPFLASQKRQPKTHRP-----IHGWIQQLTMQQLSI 191 NRE G++ L+ L +DI R + P+ PKTH P + W++ + Q+ S+ Sbjct: 506 NREKGILRKALEGILPDDILYRKKSPY-------PKTHHPEYTKGVSEWLKTIRSQKDSV 558 Query: 192 THT 200 HT Sbjct: 559 LHT 561
>E74EA_DROME (P20105) Ecdysone-induced protein 74EF isoform A (ETS-related| protein E74A) Length = 829 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 162 QQLTMQQLSITHTQQQFIHAQIRHVIKQ 245 QQL QQLS H QQQ +H Q+ H +Q Sbjct: 575 QQLAHQQLS--HQQQQALHQQLSHQQQQ 600
>PHC1_HUMAN (P78364) Polyhomeotic-like protein 1 (hPH1) (Early development| regulatory protein 1) Length = 1004 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 90 RVQPPFLASQKRQPKTHRPIHGWIQQLTMQQLSITHTQQQFIHAQ 224 ++QP L Q++Q IH +Q+ +QQ H QQQF H Q Sbjct: 373 QIQPHSLIQQQQQ------IHLQQKQVVIQQQIAIHHQQQFQHRQ 411
>E74EB_DROME (P11536) Ecdysone-induced protein 74EF isoform B (ETS-related| protein E74B) Length = 883 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 162 QQLTMQQLSITHTQQQFIHAQIRHVIKQ 245 QQL QQLS H QQQ +H Q+ H +Q Sbjct: 629 QQLAHQQLS--HQQQQALHQQLSHQQQQ 654
>PHC1_MOUSE (Q64028) Polyhomeotic-like protein 1 (mPH1) (Early development| regulatory protein 1) (RAE-28) Length = 1012 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +3 Query: 90 RVQPPFLASQKRQPKTHRPIHGWIQQLTMQQLSITHTQQQFIHAQ 224 ++QP L Q++Q IH +Q+ +QQ H QQQF H Q Sbjct: 373 QIQPHSLIQQQQQ------IHLQQKQVVIQQQIAIHHQQQFQHRQ 411
>TXND2_MOUSE (Q6P902) Thioredoxin domain-containing protein 2| (Spermatid-specific thioredoxin-1) (Sptrx-1) (Thioredoxin-4) Length = 515 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/74 (22%), Positives = 32/74 (43%) Frame = +3 Query: 33 RKNREHGLIHLDLQLKEDIRVQPPFLASQKRQPKTHRPIHGWIQQLTMQQLSITHTQQQF 212 ++ H + +Q KE + P + Q ++ KTHRP+ +Q ++ +H Q Sbjct: 274 KEGEVHKPLKDSIQSKETKVPKSPQDSIQSKEDKTHRPLKDSVQSKESEEPKSSHESIQS 333 Query: 213 IHAQIRHVIKQYTP 254 +I +K P Sbjct: 334 KEDKIHKPLKDSIP 347
>CAF1_EPHMU (P18856) Collagen EMF1-alpha precursor (Fibrillar collagen)| (Fragment) Length = 547 Score = 27.7 bits (60), Expect = 6.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 189 ITHTQQQFIHAQIRHVIKQYTPICSNLGA 275 I+ +Q QFI A RH ++ +T C N A Sbjct: 448 ISRSQLQFIRAASRHAVQSFTYKCRNSAA 476
>NPHP1_CAEEL (O17972) Nephrocystin-1-like protein (Nephronophthisis homolog)| Length = 682 Score = 27.3 bits (59), Expect = 8.8 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +3 Query: 15 NTDFS*RKNREHGLIHLDLQLKEDI--RVQPPFLASQKRQPKTHRPI 149 N D S + + +I D+QL + + + QPP Q+ QPK +PI Sbjct: 128 NDDESEDSDNDSEIIETDVQLDDPLPSQPQPPQQQHQQPQPKPRQPI 174 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,283,551 Number of Sequences: 219361 Number of extensions: 864353 Number of successful extensions: 2010 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2002 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)