| Clone Name | rbaet90f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, trac... | 29 | 3.4 | 2 | CCMA2_PSEAE (Q8GQ92) Cytochrome c biogenesis ATP-binding export ... | 28 | 5.8 | 3 | AXUD1_MOUSE (P59054) Axin-1 up-regulated gene 1 protein (TGF-bet... | 28 | 5.8 | 4 | RO60_XENLA (P42700) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro ... | 28 | 7.6 |
|---|
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 28.9 bits (63), Expect = 3.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 197 SPSISPGTTLLTPKYNPTAKD*RLTEATFVQAAAMGS 307 +PS +PGTT + P+ TA T +T ++A+G+ Sbjct: 3904 NPSSTPGTTPIPPELTTTATTPAATSSTVTPSSALGT 3940 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 197 SPSISPGTTLLTPKYNPTAKD*RLTEATFVQAAAMGS 307 +PS +PGTT + P TA T +T ++A+G+ Sbjct: 3375 NPSSTPGTTPIPPVLTTTATTPAATSSTVTPSSALGT 3411 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 197 SPSISPGTTLLTPKYNPTAKD*RLTEATFVQAAAMGSA 310 +PS SPGT P TA T T + ++++G+A Sbjct: 3182 TPSSSPGTATALPALRSTATTPTATSVTAIPSSSLGTA 3219 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 197 SPSISPGTTLLTPKYNPTAKD*RLTEATFVQAAAMGS 307 +PS +PGTT + P TA T +T ++A+G+ Sbjct: 2148 NPSSTPGTTPIPPVLTTTATTPAATSSTVTPSSALGT 2184
>CCMA2_PSEAE (Q8GQ92) Cytochrome c biogenesis ATP-binding export protein ccmA| (EC 3.6.3.41) (Heme exporter protein A) Length = 203 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = -2 Query: 230 SVELFQERWMGKERGRPHAIRGGEIVLSSPQEI 132 +++ F RW+G+ R H RGG +VL+S QE+ Sbjct: 160 ALDQFGARWLGELIHR-HQSRGGMVVLTSHQEL 191
>AXUD1_MOUSE (P59054) Axin-1 up-regulated gene 1 protein (TGF-beta-induced| apoptosis protein 3) (TAIP-3) Length = 583 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 136 SCGELKTISPPRIACGLPRSFPIHLSWNNSTDTQI*PYCEGLAA 267 SCG L++ +PP I PR P H+++N T P C+G + Sbjct: 61 SCG-LQSFTPPSILKRAPRERPGHVAFNGIT-VYYFPRCQGFTS 102
>RO60_XENLA (P42700) 60-kDa SS-A/Ro ribonucleoprotein (60 kDa Ro protein) (60| kDa ribonucleoprotein Ro) (RoRNP) (TROVE domain family member 2) Length = 538 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -1 Query: 75 EGCYLWDQTNFIRYCHCICRGKEG 4 EGCY+W ++ R +C G EG Sbjct: 20 EGCYVWQVSDMNRLRRFLCFGSEG 43 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,343,991 Number of Sequences: 219361 Number of extensions: 1034260 Number of successful extensions: 2433 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2432 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)