| Clone Name | rbaet79f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YDQ4_SCHPO (O14197) Hypothetical protein C5D6.04 in chromosome I | 28 | 4.5 | 2 | SOAT2_HUMAN (O75908) Sterol O-acyltransferase 2 (EC 2.3.1.26) (C... | 28 | 5.9 |
|---|
>YDQ4_SCHPO (O14197) Hypothetical protein C5D6.04 in chromosome I| Length = 452 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 303 VLMLQFALPPAMSIGTMAQLYDVAQEECSVIFLWTYLV 190 V+ L P A+ + + QL V + EC+ + W+Y V Sbjct: 394 VIFLLVGSPTAIQLTQICQLNGVFERECAKVLWWSYAV 431
>SOAT2_HUMAN (O75908) Sterol O-acyltransferase 2 (EC 2.3.1.26) (Cholesterol| acyltransferase 2) (Acyl coenzyme A:cholesterol acyltransferase 2) (ACAT-2) Length = 522 Score = 28.1 bits (61), Expect = 5.9 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 4/75 (5%) Frame = -2 Query: 213 IFLWTYLVAALALTAWSTVFMSILAA*YIA----STSI*ESIGLLVCILLVLHQFLLIAI 46 + ++++ LAL W +F+S L A Y A + L C LL H +L A+ Sbjct: 155 LLIFSFGQLPLALVTWVPMFLSTLLAPYQALRLWARGTWTQATGLGCALLAAHAVVLCAL 214 Query: 45 SIYVQLVFIQVSLPP 1 ++V ++ LPP Sbjct: 215 PVHVA---VEHQLPP 226 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,544,074 Number of Sequences: 219361 Number of extensions: 253170 Number of successful extensions: 627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 627 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)