| Clone Name | rbaet79d11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RENT1_MOUSE (Q9EPU0) Regulator of nonsense transcripts 1 (EC 3.6... | 29 | 3.1 | 2 | RENT1_HUMAN (Q92900) Regulator of nonsense transcripts 1 (EC 3.6... | 29 | 4.1 | 3 | RENT1_DROME (Q9VYS3) Regulator of nonsense transcripts 1 homolog | 28 | 7.0 |
|---|
>RENT1_MOUSE (Q9EPU0) Regulator of nonsense transcripts 1 (EC 3.6.1.-)| (ATP-dependent helicase RENT1) (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) (mUpf1) Length = 1113 Score = 29.3 bits (64), Expect = 3.1 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 135 DQPTHSLTHCSIADR*TYQICKAIH*FFCKGR-N*SDNFLINSL 7 D P H+ ++C I D C +FC GR N S + ++N L Sbjct: 112 DLPVHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHL 155
>RENT1_HUMAN (Q92900) Regulator of nonsense transcripts 1 (EC 3.6.1.-)| (ATP-dependent helicase RENT1) (Nonsense mRNA reducing factor 1) (NORF1) (Up-frameshift suppressor 1 homolog) (hUpf1) Length = 1129 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = -1 Query: 135 DQPTHSLTHCSIADR*TYQICKAIH*FFCKGR-N*SDNFLINSL 7 D P H+ ++C I D C +FC GR N S + ++N L Sbjct: 117 DLPIHACSYCGIHDPACVVYCNTSKKWFCNGRGNTSGSHIVNHL 160
>RENT1_DROME (Q9VYS3) Regulator of nonsense transcripts 1 homolog| Length = 1180 Score = 28.1 bits (61), Expect = 7.0 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 129 PTHSLTHCSIADR*TYQICKAIH*FFCKGR-N*SDNFLINSL 7 P H+ +C I D T +C +FC GR + S + +IN L Sbjct: 96 PPHACKYCGIHDPATVVMCNNCRKWFCNGRGSTSGSHIINHL 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,666,619 Number of Sequences: 219361 Number of extensions: 179435 Number of successful extensions: 475 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)