| Clone Name | rbaet79d04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SIGM_BACSU (O07582) RNA polymerase sigma factor sigM | 28 | 8.8 | 2 | CP1A1_MICTO (Q92148) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1) | 28 | 8.8 |
|---|
>SIGM_BACSU (O07582) RNA polymerase sigma factor sigM| Length = 163 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +3 Query: 93 DKLGETFHRGYAHLHLFDRS 152 D L ETF R Y H+H +D S Sbjct: 30 DLLQETFMRAYIHIHSYDHS 49
>CP1A1_MICTO (Q92148) Cytochrome P450 1A1 (EC 1.14.14.1) (CYPIA1)| Length = 515 Score = 27.7 bits (60), Expect = 8.8 Identities = 17/42 (40%), Positives = 23/42 (54%) Frame = +1 Query: 37 YTTVRQAMSITAGNTYEEQTNWGKLFIEDMLTYTFSTDQAGL 162 + TVRQA+ I G+ + FI D + FSTDQAG+ Sbjct: 92 HETVRQAL-IKQGHDLRPPDLYSFQFINDGKSLAFSTDQAGV 132 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,852,656 Number of Sequences: 219361 Number of extensions: 439858 Number of successful extensions: 1292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1292 length of database: 80,573,946 effective HSP length: 35 effective length of database: 72,896,311 effective search space used: 1749511464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)