ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet78g10 |
|---|---|
| Clone Library Name | barley_pub |
>ATP6_BUCBP (Q89B45) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 274 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +3 Query: 177 FTFGQIHKGVILCAAPACVG*KSNLIIPAGEM---------PWWVQYVTLTPW 308 F F I + + L + P +G + + AGEM PWW+Q++ PW Sbjct: 192 FVFNFILESISLLSKPVSLGLRLFGNMYAGEMIFILISGLLPWWLQWILSVPW 244
>ATP6_ECOLI (P0AB98) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 271 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 9/48 (18%) Frame = +3 Query: 192 IHKGVILCAAPACVG*K--SNL-------IIPAGEMPWWVQYVTLTPW 308 I +GV L + P +G + N+ I+ AG +PWW Q++ PW Sbjct: 194 ILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPW 241
>ATP6_ECO57 (P0AB99) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 271 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 9/48 (18%) Frame = +3 Query: 192 IHKGVILCAAPACVG*K--SNL-------IIPAGEMPWWVQYVTLTPW 308 I +GV L + P +G + N+ I+ AG +PWW Q++ PW Sbjct: 194 ILEGVSLLSKPVSLGLRLFGNMYAGELIFILIAGLLPWWSQWILNVPW 241
>ST1B1_CANFA (Q95JD5) Sulfotransferase family cytosolic 1B member 1 (EC 2.8.2.-)| (Sulfotransferase 1B1) (cSULT1B1) Length = 296 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -3 Query: 86 PVLLQSHTAVAVI--EFWSTNCKFIY 15 P L+++H +A++ FW NCK IY Sbjct: 103 PRLVKTHLPIALLPKSFWENNCKMIY 128
>ST1C1_HUMAN (O00338) Sulfotransferase 1C1 (EC 2.8.2.-) (SULT1C#1) (ST1C2)| (humSULTC2) Length = 296 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -3 Query: 86 PVLLQSHTAVAVI--EFWSTNCKFIY 15 P +L++H + ++ FW NCKF+Y Sbjct: 103 PRILKTHLSTQLLPPSFWENNCKFLY 128
>ATP6_BUCAP (O51878) ATP synthase a chain (EC 3.6.3.14) (ATPase protein 6)| Length = 272 Score = 27.7 bits (60), Expect = 7.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 252 IIPAGEMPWWVQYVTLTPW 308 I+ AG +PWW Q+ PW Sbjct: 224 ILIAGLLPWWSQFFLNVPW 242
>ST1C2_RAT (Q9WUW8) Sulfotransferase 1C2 (EC 2.8.2.-) (Sulfotransferase K1)| (rSULT1C2) Length = 296 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -3 Query: 86 PVLLQSHTAVAVI--EFWSTNCKFIY 15 P +L++H ++ FW+ NCKF+Y Sbjct: 103 PRILRTHLPTQLLPPSFWTNNCKFLY 128
>ST1C2_MOUSE (Q9D939) Sulfotransferase 1C2 (EC 2.8.2.-)| Length = 296 Score = 27.7 bits (60), Expect = 7.6 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -3 Query: 86 PVLLQSHTAVAVI--EFWSTNCKFIY 15 P +L++H ++ FW+ NCKF+Y Sbjct: 103 PRILRTHLPTQLLPPSFWTNNCKFLY 128
>CMTA4_ARATH (Q9FYG2) Calmodulin-binding transcription activator 4| (Signal-responsive protein 5) (Ethylene-induced calmodulin-binding protein d) (EICBP.d) (Ethylene-induced calmodulin-binding protein 4) (EICBP4) (AtFIN21) Length = 1016 Score = 27.7 bits (60), Expect = 7.6 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = +3 Query: 135 IASIDAASNRSAYSFTFGQ-------IHKGVILCAAPACVG*KSNLIIPAGE 269 I S S +S FG I +GVI C AP C K NL I +G+ Sbjct: 467 IGSFLCDPTESTWSCMFGNAQVPFEIIKEGVIRCEAPQCGPGKVNLCITSGD 518
>BLAR_BACLI (P12287) Regulatory protein blaR1| Length = 601 Score = 27.7 bits (60), Expect = 7.6 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -3 Query: 233 HTCRRST*NYSLVNLAKSKGVRAPVTGGINRCYI 132 HTC+ + V L++S +++P+T G+ R YI Sbjct: 159 HTCKEEIRFHQKVILSRSPLIKSPITFGVIRPYI 192
>ST1E1_BOVIN (P19217) Estrogen sulfotransferase (EC 2.8.2.4) (Sulfotransferase,| estrogen-preferring) (ST1E1) Length = 295 Score = 27.3 bits (59), Expect = 9.9 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -3 Query: 86 PVLLQSHTAVAV--IEFWSTNCKFIY 15 P +++SH V + + FW NCK IY Sbjct: 102 PRIVKSHLPVKLLPVSFWEKNCKIIY 127
>ST1C1_RABIT (O46503) Sulfotransferase 1C1 (EC 2.8.2.-) (rabSULT1C2)| Length = 296 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/26 (38%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -3 Query: 86 PVLLQSHTAVAVI--EFWSTNCKFIY 15 P +L++H ++ FW NCKF+Y Sbjct: 103 PRILRTHLPTRLLPPSFWENNCKFLY 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,608,705 Number of Sequences: 219361 Number of extensions: 809525 Number of successful extensions: 1451 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1427 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1451 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
