| Clone Name | rbaet77h08 |
|---|---|
| Clone Library Name | barley_pub |
>ST1B1_CANFA (Q95JD5) Sulfotransferase family cytosolic 1B member 1 (EC 2.8.2.-)| (Sulfotransferase 1B1) (cSULT1B1) Length = 296 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 97 PVLLQSHTAVAVI--EFWSTNCKFIY 26 P L+++H +A++ FW NCK IY Sbjct: 103 PRLVKTHLPIALLPKSFWENNCKMIY 128
>ST1C1_HUMAN (O00338) Sulfotransferase 1C1 (EC 2.8.2.-) (SULT1C#1) (ST1C2)| (humSULTC2) Length = 296 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 97 PVLLQSHTAVAVI--EFWSTNCKFIY 26 P +L++H + ++ FW NCKF+Y Sbjct: 103 PRILKTHLSTQLLPPSFWENNCKFLY 128
>BLAR_BACLI (P12287) Regulatory protein blaR1| Length = 601 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 244 HTCRRST*NYSLVNLAKSKGVRAPVTGGINRCYI 143 HTC+ + V L++S +++P+T G+ R YI Sbjct: 159 HTCKEEIRFHQKVILSRSPLIKSPITFGVIRPYI 192
>CMTA4_ARATH (Q9FYG2) Calmodulin-binding transcription activator 4| (Signal-responsive protein 5) (Ethylene-induced calmodulin-binding protein d) (EICBP.d) (Ethylene-induced calmodulin-binding protein 4) (EICBP4) (AtFIN21) Length = 1016 Score = 27.7 bits (60), Expect = 7.9 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 7/52 (13%) Frame = +2 Query: 146 IASIDAASNRSAYSFTFGQ-------IHKGVILCAAPACVG*KSNLIIPAGE 280 I S S +S FG I +GVI C AP C K NL I +G+ Sbjct: 467 IGSFLCDPTESTWSCMFGNAQVPFEIIKEGVIRCEAPQCGPGKVNLCITSGD 518
>MIME_BOVIN (P19879) Mimecan precursor (Osteoglycin) [Contains: Corneal keratan| sulfate proteoglycan 25 core protein (KSPG25 protein); Osteoinductive factor (OIF)] Length = 299 Score = 27.7 bits (60), Expect = 7.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 3 LNITVNILYINLQFVLQNSITATAVCDCNNTGYI 104 LN+ ++ I+LQF SIT C N+T YI Sbjct: 231 LNLPESLRVIHLQFNNITSITDDTFCKANDTSYI 264
>ST1C2_RAT (Q9WUW8) Sulfotransferase 1C2 (EC 2.8.2.-) (Sulfotransferase K1)| (rSULT1C2) Length = 296 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 97 PVLLQSHTAVAVI--EFWSTNCKFIY 26 P +L++H ++ FW+ NCKF+Y Sbjct: 103 PRILRTHLPTQLLPPSFWTNNCKFLY 128
>ST1C2_MOUSE (Q9D939) Sulfotransferase 1C2 (EC 2.8.2.-)| Length = 296 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/26 (38%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = -1 Query: 97 PVLLQSHTAVAVI--EFWSTNCKFIY 26 P +L++H ++ FW+ NCKF+Y Sbjct: 103 PRILRTHLPTQLLPPSFWTNNCKFLY 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,681,388 Number of Sequences: 219361 Number of extensions: 633010 Number of successful extensions: 1163 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1163 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)