| Clone Name | rbaet77h04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLAP2_CAEEL (Q02328) Protein SLA2 homolog | 29 | 2.8 | 2 | CPEY_SYNPY (Q02174) Bilin biosynthesis protein cpeY | 28 | 8.1 |
|---|
>SLAP2_CAEEL (Q02328) Protein SLA2 homolog| Length = 927 Score = 29.3 bits (64), Expect = 2.8 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 131 IVSFQFCHCMHIIQAERADAHLKHP*QTLHQVHRFTR 241 +++++FCH +H + D H K P +T V+RFT+ Sbjct: 65 VLTWKFCHLVHKLLR---DGHRKVPEETYRYVNRFTQ 98
>CPEY_SYNPY (Q02174) Bilin biosynthesis protein cpeY| Length = 419 Score = 27.7 bits (60), Expect = 8.1 Identities = 19/67 (28%), Positives = 29/67 (43%) Frame = -1 Query: 255 ITYAPRVNRCTWCSVCHGCLRCASALSA*IMCIQWQNWNDTMLDCLEISVTLRASRVMCL 76 I P + +C W + AL I+ Q Q + D M+D L + T + + CL Sbjct: 63 IDAVPAIGKCLWSDDVYLVENSVWALQ--ILQCQDQIFIDQMIDILRVDTTNQRISIQCL 120 Query: 75 AVDPISQ 55 A IS+ Sbjct: 121 ATLNISR 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,560,918 Number of Sequences: 219361 Number of extensions: 578723 Number of successful extensions: 1226 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1226 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)