| Clone Name | rbaet77f04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | JTB_HUMAN (O76095) Protein JTB precursor (Jumping translocation ... | 31 | 0.95 | 2 | JTB_MOUSE (O88824) Protein JTB precursor | 29 | 2.8 | 3 | SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains prote... | 28 | 4.7 | 4 | SAHH_STRAW (Q82DC9) Adenosylhomocysteinase (EC 3.3.1.1) (S-adeno... | 28 | 6.1 | 5 | JTB_RAT (O88823) Protein JTB precursor | 28 | 8.0 |
|---|
>JTB_HUMAN (O76095) Protein JTB precursor (Jumping translocation breakpoint| protein) (Prostate androgen-regulated protein) (PAR protein) Length = 146 Score = 30.8 bits (68), Expect = 0.95 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 7/43 (16%) Frame = +2 Query: 23 IPCSSTKRNKILGCRS-------LSHMEGVI*CVLYI*SCFLI 130 I CSS+KRN+ CRS EG + CV I +C +I Sbjct: 83 ITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVI 125
>JTB_MOUSE (O88824) Protein JTB precursor| Length = 146 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 7/43 (16%) Frame = +2 Query: 23 IPCSSTKRNKILGCRSL---SHM----EGVI*CVLYI*SCFLI 130 I CSS+KRN+ CRS H+ EGV+ V + +C +I Sbjct: 83 ITCSSSKRNEFKSCRSALLEQHLFWKFEGVVVAVALVFACLVI 125
>SHAN1_RAT (Q9WV48) SH3 and multiple ankyrin repeat domains protein 1 (Shank1)| (GKAP/SAPAP-interacting protein) (SPANK-1) (Synamon) (Somatostatin receptor-interacting protein) (SSTR-interacting protein) (SSTRIP) Length = 2167 Score = 28.5 bits (62), Expect = 4.7 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 6/44 (13%) Frame = -1 Query: 264 GTMTKEKMSAEEQQKGSGGSS------YTPIR*SPSPVPHCASP 151 G+ T+ + + G GGSS +P+ SPSPVP ASP Sbjct: 1181 GSSTEAEPPTQPDGAGGGGSSPSPAPATSPVPPSPSPVPTPASP 1224
>SAHH_STRAW (Q82DC9) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 28.1 bits (61), Expect = 6.1 Identities = 20/45 (44%), Positives = 22/45 (48%) Frame = -3 Query: 244 DVGRGAAEGLRGQFVHAHPLIAIPCSSLCVAMLYYLLVDQKTTLD 110 DVG+G AE LRGQ P +L AM Y Q TTLD Sbjct: 275 DVGKGCAESLRGQGARVIVTEIDPICALQAAMDGY----QVTTLD 315
>JTB_RAT (O88823) Protein JTB precursor| Length = 146 Score = 27.7 bits (60), Expect = 8.0 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 7/43 (16%) Frame = +2 Query: 23 IPCSSTKRNKILGCRSL---SHM----EGVI*CVLYI*SCFLI 130 I CSS+KRN+ CRS H+ EG++ V + +C +I Sbjct: 83 ITCSSSKRNEFKSCRSALLEQHLFWKFEGIVVGVALVFACLVI 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,788,170 Number of Sequences: 219361 Number of extensions: 679889 Number of successful extensions: 1650 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1650 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)