ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaet77f03 |
|---|---|
| Clone Library Name | barley_pub |
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESGK 206 NLRQVQCVSFIAFRPPGCEESGK Sbjct: 151 NLRQVQCVSFIAFRPPGCEESGK 173
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 52.0 bits (123), Expect = 4e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESGK 206 N+RQVQCVSFIAFRPPGCEESGK Sbjct: 152 NMRQVQCVSFIAFRPPGCEESGK 174
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 50.8 bits (120), Expect = 9e-07 Identities = 21/23 (91%), Positives = 23/23 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESGK 206 N+RQVQCVSFIAF+PPGCEESGK Sbjct: 90 NMRQVQCVSFIAFKPPGCEESGK 112
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 49.7 bits (117), Expect = 2e-06 Identities = 20/23 (86%), Positives = 23/23 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESGK 206 N+RQVQCVSFIAF+PPGC+ESGK Sbjct: 151 NMRQVQCVSFIAFKPPGCQESGK 173
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 43.9 bits (102), Expect = 1e-04 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESGK 206 N+RQVQ VSFIA +PPGCEESGK Sbjct: 152 NMRQVQSVSFIASKPPGCEESGK 174
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESG 209 N+RQVQ +SFIA++PPGCEESG Sbjct: 152 NVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 43.1 bits (100), Expect = 2e-04 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESG 209 N+RQVQ +SFIA++PPGCEESG Sbjct: 152 NVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 36.2 bits (82), Expect = 0.022 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N RQVQCVSFIAF+PPG Sbjct: 163 NKRQVQCVSFIAFKPPG 179
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 35.8 bits (81), Expect = 0.029 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++PPG Sbjct: 161 NVRQVQCISFIAYKPPG 177
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++PPG Sbjct: 163 NVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 35.8 bits (81), Expect = 0.029 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++PPG Sbjct: 163 NVRQVQCISFIAYKPPG 179
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 35.0 bits (79), Expect = 0.050 Identities = 16/22 (72%), Positives = 19/22 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEESG 209 N+RQVQ +SFIA+ PGCEESG Sbjct: 150 NVRQVQLISFIAYN-PGCEESG 170
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 35.0 bits (79), Expect = 0.050 Identities = 12/17 (70%), Positives = 17/17 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SF+A++PPG Sbjct: 165 NVRQVQCISFLAYKPPG 181
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 34.3 bits (77), Expect = 0.085 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCE 218 N++Q QCVSFIA++PPG + Sbjct: 152 NIKQTQCVSFIAYKPPGSD 170
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 33.9 bits (76), Expect = 0.11 Identities = 12/19 (63%), Positives = 17/19 (89%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCE 218 N+RQVQC+SF+A++P G E Sbjct: 165 NVRQVQCISFLAYKPKGAE 183
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEES 212 N RQVQC+SFIA++PP E+ Sbjct: 161 NTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPGCEES 212 N RQVQC+SFIA++PP E+ Sbjct: 161 NTRQVQCISFIAYKPPSFTEA 181
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N+RQVQC+SFIA++PP Sbjct: 161 NVRQVQCISFIAYKPP 176
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N+RQVQC+SFIA++PP Sbjct: 161 NVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 33.5 bits (75), Expect = 0.14 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N+RQVQC+SFIA++PP Sbjct: 161 NVRQVQCISFIAYKPP 176
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 165 NVRQVQCISFIAYKPKG 181
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 163 NVRQVQCISFIAYKPEG 179
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 161 NTRQVQCISFIAYKPP 176
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 166 NVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 166 NVRQVQCISFIAYKPAG 182
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFI +PPG Sbjct: 163 NIRQVQCISFIVAKPPG 179
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 164 NVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 164 NVRQVQCISFIAYKPEG 180
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 164 NVRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 164 NVRQVQCISFIAYKPEG 180
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 161 NTRQVQCISFIAYKPP 176
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/17 (70%), Positives = 16/17 (94%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA++P G Sbjct: 164 NVRQVQCISFIAYKPEG 180
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 32.3 bits (72), Expect = 0.32 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 165 NKRQVQCISFIAYKPP 180
>L_SYNV (P31332) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2116 Score = 32.3 bits (72), Expect = 0.32 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 9 KQSMYSRYYDSHMHLPRPTLVGAYIHMLVYSHMIGTRSKIE 131 K + ++ YYD H H P TL H +YS + R KIE Sbjct: 405 KLTFFTNYYDKHHHYPLSTLTHP-DHFNLYSQYLSERDKIE 444
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 62 NNRQVQCISFIAYKPP 77
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N RQVQCVSFIA++P G Sbjct: 165 NKRQVQCVSFIAYKPAG 181
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 161 NNRQVQCISFIAYKPP 176
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 161 NNRQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 32.0 bits (71), Expect = 0.42 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPP 227 N RQVQC+SFIA++PP Sbjct: 161 NNRQVQCISFIAYKPP 176
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 31.2 bits (69), Expect = 0.72 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQCVSFIA++P Sbjct: 163 NVRQVQCVSFIAYKP 177
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 31.2 bits (69), Expect = 0.72 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N RQVQC+SFIA++P G Sbjct: 163 NNRQVQCISFIAYKPTG 179
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQCVSFIA +P G Sbjct: 156 NVRQVQCVSFIASKPTG 172
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 31.2 bits (69), Expect = 0.72 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQCVSFIA++P Sbjct: 164 NVRQVQCVSFIAYKP 178
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 31.2 bits (69), Expect = 0.72 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQCVSFIA++P Sbjct: 167 NVRQVQCVSFIAYKP 181
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N RQVQ +SFIA++PPG Sbjct: 165 NKRQVQIISFIAYKPPG 181
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA++P Sbjct: 163 NVRQVQCISFIAYKP 177
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA++P Sbjct: 163 NVRQVQCISFIAYKP 177
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA++P Sbjct: 161 NVRQVQCISFIAYKP 175
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA +P G Sbjct: 156 NVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA +P G Sbjct: 156 NVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA +P G Sbjct: 156 NVRQVQCISFIASKPDG 172
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA++P Sbjct: 163 NVRQVQCISFIAYKP 177
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA +P G Sbjct: 161 NVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA +P G Sbjct: 161 NVRQVQCISFIASKPEG 177
>CYB_CEPNE (Q34179) Cytochrome b| Length = 380 Score = 30.8 bits (68), Expect = 0.94 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 6/75 (8%) Frame = +3 Query: 3 SCKQSMYSRYYDSHMHLPRPTLVGAYIHMLVY-----SHMIGTRSKIEKAEL-PTDQCEL 164 S Q+ +R+Y H LP LV +H+L+ S+ +G S + K P ++ Sbjct: 165 SVNQATLNRFYSFHFLLPFVILVFVLVHLLLLHDKGSSNPLGNMSHVSKVSFHPYFTWKI 224 Query: 165 TWHVYRLLQLALYAL 209 W V+ LL LY L Sbjct: 225 LW-VFVLLCFLLYVL 238
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA++P Sbjct: 164 NVRQVQCISFIAYKP 178
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 30.8 bits (68), Expect = 0.94 Identities = 11/15 (73%), Positives = 15/15 (100%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA++P Sbjct: 165 NVRQVQCISFIAYKP 179
>NCAP_TPMV (Q9WS40) Nucleoprotein (Protein N) (Nucleocapsid protein) (NP| protein) Length = 552 Score = 30.8 bits (68), Expect = 0.94 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +3 Query: 105 MIGTRSKIEKAELPTDQCELTWHVYRLLQLALY--ALPDSSQPGGLKAM 245 ++G RS + T L W + RLL LA+Y +LPDS G L ++ Sbjct: 28 LVGVRSTVVVLVPSTKDHRLRWKLIRLLTLAVYNDSLPDSISIGALLSL 76
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 268 RQVQCVSFIAFRPPG 224 RQVQCVSFIA++P G Sbjct: 165 RQVQCVSFIAYKPAG 179
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+SFIA +P G Sbjct: 156 NVRQVQCISFIASKPGG 172
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQCVSFIA++P Sbjct: 166 NKRQVQCVSFIAYKP 180
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 30.0 bits (66), Expect = 1.6 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N+RQVQC+ FIA RP G Sbjct: 161 NVRQVQCIMFIASRPDG 177
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 162 NKRQVQCISFIAYKP 176
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 162 NKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 162 NKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 162 NKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 162 NKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 162 NKRQVQCISFIAYKP 176
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 29.6 bits (65), Expect = 2.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -2 Query: 274 NLRQVQCVSFIAFRPPG 224 N RQVQC+SF+ ++P G Sbjct: 161 NTRQVQCISFLTYKPEG 177
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 29.6 bits (65), Expect = 2.1 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N RQVQC+SFIA++P Sbjct: 158 NKRQVQCISFIAYKP 172
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 28.9 bits (63), Expect = 3.6 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = -2 Query: 268 RQVQCVSFIAFRPPG 224 R+VQC+SFIA++P G Sbjct: 108 REVQCISFIAYKPAG 122
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/15 (73%), Positives = 14/15 (93%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA +P Sbjct: 156 NVRQVQCISFIASKP 170
>SBCC_VIBCH (Q9KM67) Nuclease sbcCD subunit C| Length = 1013 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 117 RSKIEKAELPTDQCELTWHVYRLLQLAL 200 +++ E+A+L D+ E WH R +LAL Sbjct: 472 QTQAEQAKLTADKLEFAWHTQRAAELAL 499
>RBS1_FRIAG (O24634) Ribulose bisphosphate carboxylase small chain 1/4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1/4) Length = 179 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQCVSFI RP Sbjct: 164 NVRQVQCVSFIVERP 178
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA P Sbjct: 163 NVRQVQCISFIAHTP 177
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA P Sbjct: 163 NVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA P Sbjct: 163 NVRQVQCISFIAHTP 177
>RBS1_PEA (P00868) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (PSSU1) (Fragment) Length = 136 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA P Sbjct: 119 NVRQVQCISFIAHTP 133
>RBS_TRIRP (P17673) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFIA P Sbjct: 161 NVRQVQCISFIASTP 175
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFI +P Sbjct: 172 NVRQVQCISFIVHKP 186
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 274 NLRQVQCVSFIAFRP 230 N+RQVQC+SFI +P Sbjct: 156 NVRQVQCISFIVHKP 170 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,615,657 Number of Sequences: 219361 Number of extensions: 699758 Number of successful extensions: 1624 Number of sequences better than 10.0: 89 Number of HSP's better than 10.0 without gapping: 1603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1623 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
