| Clone Name | rbaet77c11 |
|---|---|
| Clone Library Name | barley_pub |
>RGA7_SCHPO (O94466) Probable Rho-GTPase-activating protein 7| Length = 695 Score = 30.4 bits (67), Expect = 1.3 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 71 HKNTKEKRQKVKERARNKKNAY 136 HKN + KR+ +KE A+ ++NAY Sbjct: 137 HKNAERKRKSIKEYAKKQENAY 158
>UVH1_ARATH (Q9LKI5) DNA repair endonuclease UVH1 (EC 3.1.-.-) (Ultraviolet| hypersensitive 1) (AtRAD1) (DNA excision repair protein XP-F homolog) Length = 956 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 43 KLHLSTLHTPQKHQRKTPKG 102 K+ L ++ TPQK ++KTPKG Sbjct: 455 KIELRSMQTPQKKKQKTPKG 474
>PDIA5_RAT (Q5I0H9) Protein disulfide-isomerase A5 precursor (EC 5.3.4.1)| Length = 517 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 105 KREHVIKKTLTPHLPHLAKLILHFTVTA 188 K++H + P PH K+I HFT TA Sbjct: 411 KKKHTLVMFYAPWCPHCKKVIPHFTATA 438
>PDIA5_MOUSE (Q921X9) Protein disulfide-isomerase A5 precursor (EC 5.3.4.1)| (Protein disulfide isomerase-related protein) Length = 517 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 105 KREHVIKKTLTPHLPHLAKLILHFTVTA 188 K++H + P PH K+I HFT TA Sbjct: 411 KKKHTLVMFYAPWCPHCKKVIPHFTATA 438
>POLS_CHIKN (Q5WQY5) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1248 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 68 PHKNTKEKRQKVKERA-RNKKNAYSTPPPSR 157 P KN K K+QK K++A RN N PP + Sbjct: 61 PRKNRKNKKQKQKQQAPRNNMNQKKQPPKKK 91
>PDIA5_HUMAN (Q14554) Protein disulfide-isomerase A5 precursor (EC 5.3.4.1)| (Protein disulfide isomerase-related protein) Length = 519 Score = 29.3 bits (64), Expect = 2.9 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 105 KREHVIKKTLTPHLPHLAKLILHFTVTA 188 K++H + P PH K+I HFT TA Sbjct: 413 KKKHTLVMFYAPWCPHCKKVIPHFTATA 440
>YNJ1_YEAST (P53935) Hypothetical 141.5 kDa protein in YPT53-RHO2 intergenic| region Length = 1240 Score = 28.9 bits (63), Expect = 3.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 77 NTKEKRQKVKERARNKKNAYSTPPPS 154 N+K KR+K K + NKKN S P S Sbjct: 4 NSKSKRRKNKSKQHNKKNGNSDPEQS 29
>SYTL4_MOUSE (Q9R0Q1) Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin)| Length = 673 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 11/53 (20%) Frame = +3 Query: 81 PKKNAKRLKREHVIKKTLTPHLPH-----------LAKLILHFTVTARDPIGA 206 P +N ++ V+KKTL+PH H L + L TV R+P+ + Sbjct: 559 PMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLAS 611
>SYTL4_RAT (Q8VHQ7) Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin)| Length = 672 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 11/53 (20%) Frame = +3 Query: 81 PKKNAKRLKREHVIKKTLTPHLPH-----------LAKLILHFTVTARDPIGA 206 P +N ++ V+KKTL PH H L + L TV R+P+ + Sbjct: 558 PMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLAS 610
>SYTL4_HUMAN (Q96C24) Synaptotagmin-like protein 4 (Exophilin-2) (Granuphilin)| Length = 671 Score = 28.1 bits (61), Expect = 6.5 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 11/53 (20%) Frame = +3 Query: 81 PKKNAKRLKREHVIKKTLTPHLPH-----------LAKLILHFTVTARDPIGA 206 P +N ++ V+KKTL PH H L + L TV R+P+ + Sbjct: 557 PMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLAS 609
>POLS_CHIKS (Q8JUX5) Structural polyprotein (p130) [Contains: Capsid protein| (EC 3.4.21.-) (Coat protein) (C); p62 (E3/E2); E3 protein (Spike glycoprotein E3); E2 envelope glycoprotein (Spike glycoprotein E2); 6K protein; E1 envelope glycoprotein (Spike g Length = 1248 Score = 27.7 bits (60), Expect = 8.6 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 68 PHKNTKEKRQKVKERA-RNKKNAYSTPPPSR 157 P KN K K+QK K++A +N N PP + Sbjct: 61 PRKNRKNKKQKQKQQAPQNNTNQKKQPPKKK 91 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,325,966 Number of Sequences: 219361 Number of extensions: 442869 Number of successful extensions: 1551 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1547 length of database: 80,573,946 effective HSP length: 44 effective length of database: 70,922,062 effective search space used: 1702129488 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)