| Clone Name | rbaet77c07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrin... | 29 | 2.8 | 2 | YP66_CAEEL (Q09215) Hypothetical protein B0495.6 | 28 | 4.8 | 3 | NBEA_CHICK (Q9DDD5) Protein neurobeachin (Fragment) | 28 | 6.2 | 4 | ZNF80_MACMU (P51505) Zinc finger protein 80 | 28 | 6.2 | 5 | ZNF80_PONPY (P51507) Zinc finger protein 80 | 28 | 6.2 | 6 | ZNF80_PANTR (P51506) Zinc finger protein 80 | 28 | 6.2 | 7 | ZNF80_GORGO (P51503) Zinc finger protein 80 | 28 | 6.2 | 8 | SCM_DROME (Q9VHA0) Polycomb protein Scm (Sex comb on midleg prot... | 28 | 8.2 |
|---|
>TIP22_ORYSA (Q5Z6F0) Probable aquaporin TIP2.2 (Tonoplast intrinsic protein| 2.2) (OsTIP2.2) Length = 248 Score = 29.3 bits (64), Expect = 2.8 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = -3 Query: 249 RYLYMCDNHTPVASND 202 RY+YMC +H PVAS++ Sbjct: 232 RYVYMCGDHAPVASSE 247
>YP66_CAEEL (Q09215) Hypothetical protein B0495.6| Length = 87 Score = 28.5 bits (62), Expect = 4.8 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 8/68 (11%) Frame = +3 Query: 9 HIILQIEKHASSKCYNFTGLRSEPNNMTFFTSSRH------SDHHARTFLCC--RRHHGN 164 H++ Q+E H SK Y T +R EP+ M ++ RH S + + C R N Sbjct: 9 HVLAQLE-HLQSK-YTGTAMRHEPSRMDCESAPRHSRLSNVSSRNEHVYCRCGEREPSSN 66 Query: 165 QTPNDPSH 188 +D SH Sbjct: 67 PLQSDKSH 74
>NBEA_CHICK (Q9DDD5) Protein neurobeachin (Fragment)| Length = 793 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 122 PRTHFFMLPKASWKPNTERPFTWMAX*SLLATGVWLSH 235 PRT+ F +P+ W P +R T + VW SH Sbjct: 422 PRTNMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSH 459
>ZNF80_MACMU (P51505) Zinc finger protein 80| Length = 293 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 246 YLYMCDNHTPVASNDX*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 109 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 248 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 293
>ZNF80_PONPY (P51507) Zinc finger protein 80| Length = 273 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 246 YLYMCDNHTPVASNDX*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 109 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 228 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 273
>ZNF80_PANTR (P51506) Zinc finger protein 80| Length = 273 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 246 YLYMCDNHTPVASNDX*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 109 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 228 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 273
>ZNF80_GORGO (P51503) Zinc finger protein 80| Length = 273 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = -3 Query: 246 YLYMCDNHTPVASNDX*AIHVKGRSVFGFHDAFGNIKKCVRGGQNV 109 Y Y HT + + ++ R FG+H AF K GG+N+ Sbjct: 228 YSYSLTRHTRSHTGEKPYECLEHRKAFGYHSAFAQQSKIHSGGKNL 273
>SCM_DROME (Q9VHA0) Polycomb protein Scm (Sex comb on midleg protein)| Length = 877 Score = 27.7 bits (60), Expect = 8.2 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 7/64 (10%) Frame = +3 Query: 18 LQIEKHASSKCYNFTGLRSEPNNMTFFTSSR-------HSDHHARTFLCCRRHHGNQTPN 176 L +++SK N ++SEPN TSS HHA T +GNQ + Sbjct: 607 LNNNNNSASKSSNKVVIKSEPNGANAQTSSTTQALRKVRFQHHANTNTNSSATNGNQDTS 666 Query: 177 DPSH 188 +H Sbjct: 667 QTTH 670 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,698,320 Number of Sequences: 219361 Number of extensions: 617964 Number of successful extensions: 1320 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1320 length of database: 80,573,946 effective HSP length: 59 effective length of database: 67,631,647 effective search space used: 1623159528 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)